Details for Lyrate rockcress Locus 16050049

Position : sca3 ( 5`- 3340212 .. 3341594 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050049

Protein [Map View]
MATLGFNTTRIQTPSLPRIPKPSSFTKPIKTHHLFSSETLLKRCRFVSRSLPESSLSITKEQEVANEVEEDDPTSELSYL
DPESDADSIKEWELDFCSRPILDSRGKKIWELVVCDASLSLQVTKYFPNNVINSITLKDAIVTITQDLGVPLPEKIRFFR
SQMQTIITKACKELAIKAVPSKRCLSLFLWLQERYDTVYTRHPGFQKGSLPLLSLDNPFPMNLPENLFGEKWAFVQLPYS
AVREEISDFEEKFVFGATLDLDLLGIEVDENTLIPGLSVATSRAKPLAAWMNGLEVCSIEADSSKGCLILSVGIATRYVY
ATYKKTPVTTDEAEAWESAKKASGGLHFLAIQDDLDSDDCVGFWLLIDLPPPPV*

DNA
ATGGCGACGTTAGGCTTTAACACCACTCGAATCCAGACACCATCACTTCCGAGAATCCCTAAACCTTCTTCTTTTACTAA
ACCCATCAAAACTCATCATCTCTTCTCCTCCGAAACTCTGTTGAAACGCTGTCGTTTCGTGTCTAGATCGTTGCCTGAGA
GCTCACTGTCGATTACAAAAGAACAAGAGGTAGCTAATGAAGTAGAGGAAGATGATCCAACGTCGGAGCTTAGTTATCTG
GATCCGGAATCCGATGCCGATAGCATCAAAGAGTGGGAATTGGATTTCTGCTCGAGGCCAATTCTTGATTCCAGAGGGAA
AAAGATTTGGGAGCTTGTGGTTTGTGATGCTTCACTCTCCCTTCAAGTCACTAAATACTTCCCCAATAATGTCATTAATA
GTATTACCCTCAAAGACGCCATTGTTACCATCACTCAAGACTTGGGTGTTCCTCTTCCTGAGAAGATTCGCTTCTTCAGG
TCACAGATGCAAACCATTATCACAAAAGCTTGCAAAGAGCTTGCCATAAAGGCAGTGCCTAGTAAACGGTGTCTGTCTCT
GTTTCTTTGGTTGCAAGAACGTTATGACACTGTGTACACGCGTCATCCCGGGTTTCAAAAGGGATCATTGCCTCTTCTGT
CTCTAGACAATCCCTTTCCAATGAATCTTCCGGAGAACTTGTTTGGGGAGAAATGGGCATTTGTTCAACTACCTTACTCA
GCTGTTAGAGAGGAGATCTCAGACTTTGAGGAGAAGTTTGTGTTTGGTGCTACCTTAGACTTGGATTTGCTTGGCATTGA
AGTGGATGAAAATACACTGATTCCTGGTCTCTCTGTTGCTACTTCACGAGCGAAACCTCTAGCAGCTTGGATGAATGGGC
TTGAAGTATGTTCGATTGAAGCAGACAGTTCCAAAGGATGTTTGATTCTATCTGTTGGGATCGCGACAAGGTATGTCTAC
GCAACCTACAAGAAGACACCTGTTACTACTGATGAAGCTGAAGCTTGGGAATCTGCAAAGAAAGCAAGTGGAGGTTTGCA
TTTTCTTGCAATTCAAGATGACTTAGATTCTGATGACTGTGTTGGCTTTTGGCTTCTTATTGATTTGCCACCACCCCCTG
TTTGA