Details for Lyrate rockcress Locus 16050038

Position : sca3 ( 5`- 3852741 .. 3851756 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16050038

Protein [Map View]
MAEEFDGKIESKGLNPGLIVLLVIGGLLVTFLVGNFILYTYAQKNLPPRKKKPVSKKKMKKEKMKQGVQVP

DNA
ATGGCCGAAGAATTTGATGGAAAAATCGAAAGCAAAGGGCTAAACCCGGGACTGATTGTCCTTCTTGTAATTGGAGGGTT
GCTTGTGACATTCCTTGTAGGAAACTTCATCCTTTACACATACGCACAGAAGAATTTACCTCCGAGGAAGAAGAAACCGG
TTTCTAAGAAGAAGATGAAGAAAGAGAAGATGAAGCAAGGCGTCCAAGTTCCT