Details for Lyrate rockcress Locus 16050026

Position : sca3 ( 5`- 5160333 .. 5161969 -3` )
Annotation : [B2G] oxidoreductase [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16050026

Protein [Map View]
MAINFEDQTTLFNFVVTEGNGVKGMIDSGLSSVPQPFVQPLSERIPTQKALTCEATQPIDLSKLDGPQHKEVAKQIVEAA
ETLGFFQVVNHGVSVELLELLKSSAHEFFAQAPEEKAMYLKEVSPSKLVKYGTSFVPDKEKAIEWKDYVSMLYTNDSEAL
QHWPQPCREMALEFLKSSMEMVKNVVNILMENVGVTLEEEKMNGLMGTKMVNMNYYPTCPSPELTIGVGRHSDMGMLTVL
LQDGIGGLYVKLDNGEWAEIPPVHGALVINIGDTLQILSNGKYKSAEHRVRTTNIGSRVSVPIFTAPNPSEKIGPLPEVV
KRDGVARYKEILFQDYMNNFFGQPHDGKKSLDFARAE*

DNA
ATGGCTATCAATTTCGAGGACCAAACCACATTGTTCAATTTCGTGGTCACAGAAGGTAACGGCGTGAAAGGAATGATTGA
CTCGGGCCTCTCTAGTGTTCCACAGCCCTTCGTCCAGCCTCTCTCTGAGCGAATCCCGACCCAAAAAGCCCTTACGTGTG
AGGCTACCCAGCCTATCGATCTTTCCAAGCTAGACGGCCCACAACACAAGGAGGTGGCCAAGCAGATCGTCGAAGCTGCC
GAGACACTTGGCTTCTTCCAGGTGGTGAACCATGGTGTTTCGGTGGAGCTGCTGGAATTGCTAAAATCGTCCGCTCATGA
GTTTTTTGCACAAGCTCCTGAGGAAAAAGCCATGTACCTGAAAGAAGTGAGTCCAAGCAAGCTGGTTAAGTACGGAACGA
GCTTCGTACCAGATAAGGAGAAGGCGATTGAGTGGAAGGATTATGTGAGCATGCTTTACACCAATGACAGTGAGGCTCTT
CAACACTGGCCTCAACCATGCAGGGAGATGGCACTTGAGTTCCTAAAATCATCGATGGAAATGGTGAAAAATGTAGTTAA
CATTCTGATGGAGAATGTTGGAGTGACACTAGAAGAAGAGAAAATGAATGGTTTGATGGGAACCAAGATGGTCAACATGA
ACTACTACCCCACTTGTCCGAGCCCGGAGCTGACCATTGGCGTCGGCCGTCACTCCGACATGGGAATGTTGACCGTTTTA
TTACAAGACGGCATTGGCGGTCTCTACGTTAAACTAGACAACGGTGAATGGGCCGAGATCCCTCCTGTCCATGGAGCTTT
GGTCATCAACATCGGCGACACTTTGCAGATTTTGAGCAATGGGAAGTACAAAAGTGCTGAGCATAGGGTTCGAACTACAA
ACATCGGATCAAGAGTCTCTGTGCCCATTTTCACGGCACCTAATCCCTCCGAGAAGATCGGTCCGTTGCCGGAAGTTGTG
AAACGCGACGGAGTGGCTCGTTACAAGGAGATTTTGTTTCAAGACTACATGAATAACTTCTTCGGCCAACCACACGACGG
AAAAAAATCTCTGGACTTCGCACGTGCCGAGTGA