Details for Lyrate rockcress Locus 16050011

Position : sca3 ( 5`- 3808414 .. 3810248 -3` )
Annotation : [B2G] myb family transcription factor
External links : CoGe
PGDD synteny : 16050011

Protein [Map View]
MSSSPSRNPTNAEAPPPQPTSTDAVAEGSSKKVRKPYTITKSRESWTEEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQI
RSHAQKYFLKVQKNGTLAHVPPPRPKRKAAHPYPQKASKNAQMPLQVSTSFTTSRNSDMPGYASWDDASMLLNRVISPQH
ELATLRGAEADIGSKGLLNVSSPSTSCMGSSSRTVSGSEIVRKAKQPPVLHGVPDFAEVYNFIGSVFDPETRGHVEKLKE
MDPINFETVLLLMRNLTVNLSNPDLESARKVLSSYDVKTELPSVVSLVKNSTSDKSA*

DNA
ATGAGCTCGTCGCCGTCAAGGAATCCGACGAACGCCGAAGCACCTCCGCCACAACCAACATCCACGGATGCGGTGGCAGA
GGGTTCGTCTAAGAAAGTGAGGAAACCTTATACCATCACTAAGTCTAGGGAGAGCTGGACTGAGGAAGAGCATGATAAGT
TTCTTGAAGCACTTCAACTGTTTGATCGTGATTGGAAGAAGATTGAAGATTTTGTTGGTTCAAAGACTGTGATTCAGATA
AGGAGCCATGCCCAAAAATACTTTCTAAAGGTTCAGAAAAACGGGACATTAGCTCATGTGCCACCTCCTCGGCCTAAGCG
CAAAGCAGCTCATCCGTATCCTCAAAAGGCATCGAAGAACGCTCAAATGCCACTACAAGTTTCCACGTCTTTTACTACTT
CGCGAAATAGCGATATGCCGGGATATGCTTCATGGGATGATGCCTCAATGCTGCTAAACAGAGTTATTTCACCACAACAT
GAACTTGCTACTCTTCGTGGAGCAGAAGCTGATATTGGATCGAAGGGCTTATTAAATGTTAGTAGCCCTTCTACATCTTG
TATGGGAAGCTCAAGCCGAACAGTATCAGGTTCTGAGATTGTAAGAAAGGCGAAACAGCCTCCCGTGCTTCACGGTGTTC
CTGATTTTGCTGAAGTTTATAACTTCATTGGGAGTGTCTTTGATCCTGAAACTAGAGGCCACGTGGAAAAGCTCAAGGAA
ATGGATCCTATAAATTTCGAAACTGTTCTGTTATTGATGAGAAACCTCACAGTTAACTTATCAAACCCTGATTTAGAATC
CGCTAGGAAAGTCCTCTCATCATATGACGTGAAGACCGAGCTCCCGAGCGTTGTTTCCCTTGTCAAGAACTCAACAAGCG
ACAAATCAGCTTAA