Details for Lyrate rockcress Locus 16050010

Position : sca3 ( 5`- 9469326 .. 9470479 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16050010

Protein [Map View]
MAELLVEETRIPQQKHYKSKPFPAVISPPSSSIPIPAVSLPLFTQSIKNQKPYLDSLLHESGTVIFRGFPVNSAEDFNDV
VEAFGFDEFPYVGGAAPRTSVVGRVFTANESPPDQKIPFHHEMAQVPEFPSKLFFYCEIEPKSGGETPIVLSHVVYERMK
EKHPEFVQRLEEHGLLYVRVLGEDDDPSSPIGRGWKSTFLTHDKNLAEQRAANLGMKLEWTEDGGAKTVMGPIPAIKYDE
SRNRKVWFNSMVAAYTGWEDKRNDPRKAVTFGDGKPLPEDIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPFEP
PRRVLASLCK*

DNA
ATGGCGGAATTGTTGGTGGAAGAAACTCGAATCCCACAGCAAAAGCACTACAAATCCAAACCATTCCCGGCGGTGATATC
ACCACCGTCTTCGTCGATTCCGATTCCTGCTGTGTCTCTTCCACTATTCACTCAGAGTATCAAGAATCAGAAACCCTACC
TCGATTCGCTCTTGCACGAATCCGGAACAGTGATATTCAGAGGTTTTCCGGTGAATTCCGCCGAGGATTTCAACGACGTC
GTTGAAGCTTTCGGTTTCGATGAGTTTCCTTACGTCGGAGGCGCTGCTCCTCGCACTAGCGTCGTCGGCCGTGTCTTCAC
TGCTAATGAATCTCCTCCTGATCAGAAGATTCCTTTTCACCACGAGATGGCTCAGGTACCTGAGTTTCCATCAAAGTTGT
TCTTTTACTGTGAGATTGAGCCTAAATCTGGTGGAGAGACTCCAATTGTGTTGAGTCATGTTGTGTATGAGAGAATGAAA
GAGAAACATCCAGAGTTTGTTCAAAGATTGGAGGAACATGGTTTGCTTTATGTTAGGGTTTTAGGTGAAGATGATGATCC
TTCATCTCCCATTGGACGTGGTTGGAAATCTACTTTCTTGACCCATGACAAGAACCTTGCTGAGCAAAGGGCGGCTAATT
TGGGAATGAAATTGGAATGGACAGAGGATGGTGGAGCCAAGACGGTAATGGGTCCGATACCGGCTATCAAATATGACGAG
TCGAGAAACCGCAAAGTATGGTTTAATAGTATGGTAGCTGCTTATACGGGCTGGGAGGATAAGCGGAATGATCCAAGAAA
GGCTGTGACTTTTGGGGATGGAAAGCCTTTACCCGAGGATATAGTTCATGACTGTCTCAGAATCCTTGAAGAGGAATGTG
TTGCTGTTCCGTGGCAGAGAGGAGATGTTCTGCTTATCGATAACTGGGCGGTTCTTCACTCTCGAAGACCATTTGAACCT
CCTCGCCGGGTTCTTGCATCACTCTGCAAATAG