Details for Lyrate rockcress Locus 16050003

Position : sca3 ( 5`- 2783504 .. 2782989 -3` )
Annotation : [B2G] mads-box family protein
External links : CoGe
PGDD synteny : 16050003

Protein [Map View]
MEKVQDTNTKQVTFSKRRLGLFKKASELATLCNAEVGIVVFSPGNKPYSFGKPNFDLIAERFKNEFEEEEEADSCETSGY
SRGKRARQEKKICKRLNSIIEEAEAEKKHGEDLHKWLESAQQDRFNKPIEELTLEELKEFEAKIQETRCGIQSNINHMQA
SSSLMFLSKDN*

DNA
ATGGAGAAAGTGCAAGACACAAACACAAAGCAAGTTACCTTCTCGAAGCGTAGGCTGGGTTTGTTCAAGAAAGCGAGTGA
GCTTGCGACGCTGTGCAACGCCGAGGTTGGTATTGTTGTCTTTTCTCCAGGAAACAAACCTTATTCCTTCGGGAAACCGA
ATTTTGATTTGATTGCAGAACGGTTTAAGAATGAATTCGAAGAAGAAGAAGAAGCAGATAGCTGTGAAACATCAGGCTAT
AGTAGAGGCAAGAGAGCTAGACAAGAGAAGAAGATATGTAAACGCCTCAACTCGATCATCGAAGAAGCTGAAGCTGAGAA
GAAACATGGAGAAGATCTTCACAAGTGGCTTGAATCTGCTCAACAAGATAGGTTTAATAAGCCCATTGAGGAGCTTACTC
TTGAGGAGCTCAAAGAATTTGAAGCTAAGATTCAAGAAACAAGGTGTGGGATTCAAAGTAACATTAATCATATGCAGGCT
TCGTCTTCTCTCATGTTTCTCTCTAAGGATAATTAG