Details for Lyrate rockcress Locus 16049991

Position : sca3 ( 5`- 10103816 .. 10104617 -3` )
Annotation : [B2G] protease inhibitor seed storage lipid transfer protein family protein
External links : CoGe
PGDD synteny : 16049991

Protein [Map View]
MSKILVVVVAMIAVLAFPIRSQQQPLSQCTPSMMTTVSPCMNFITNSSSNGTSPSSDCCNSLRSLTTGGMGCLCLIVTGT
VPFNIPINRTTAVSLPRACNMPRVPLQCQANIAPAAAPGPAGTFGPSMSPGPATNPIVPEPTASAQTPQSDTTRPFTPSA
DGGAPTSDDGGSTSRPSETPSSAYALSPSLFLFSIALVALKFY*

DNA
ATGTCGAAGATTCTAGTCGTGGTGGTGGCGATGATAGCAGTGCTTGCTTTTCCGATTCGCAGTCAACAACAACCACTTAG
CCAATGTACTCCGTCTATGATGACCACTGTAAGTCCTTGTATGAACTTCATAACCAACAGTAGCAGCAACGGAACTTCGC
CGTCGTCTGATTGTTGCAATTCGCTGAGGTCTTTGACCACCGGAGGGATGGGATGTCTCTGTCTAATTGTCACTGGAACT
GTGCCTTTCAATATTCCGATTAACCGCACAACCGCCGTCTCTCTTCCTCGTGCTTGTAACATGCCTAGAGTCCCTCTTCA
ATGCCAAGCCAATATTGCTCCAGCTGCTGCTCCTGGACCTGCTGGTACATTTGGACCGTCGATGTCTCCAGGTCCAGCGA
CGAATCCTATAGTCCCAGAGCCAACTGCGTCAGCTCAGACACCACAGTCTGATACAACCCGACCTTTCACACCATCTGCC
GATGGTGGAGCTCCAACATCAGACGACGGAGGCAGCACCAGTCGACCTTCTGAGACTCCTTCATCTGCTTACGCACTCTC
ACCATCTCTTTTCTTATTCAGCATCGCCCTCGTAGCTCTCAAATTCTACTAA