Details for Lyrate rockcress Locus 16049982

Position : sca3 ( 5`- 10407822 .. 10407210 -3` )
Annotation : [B2G] indoleacetic acid-induced protein 2
External links : CoGe
PGDD synteny : 16049982

Protein [Map View]
MAYEKVNELNLKDTELCLGLPGRTEEIKEEQEVSCVKSNNKRQFEDTREEEESTPPTKTQIVGWPPVRSSRKNNNSVSYV
KVSMDGAPYLRKIDLKTYKNYPELLKALENMFKVTIGEYCEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCKRLR
IMKGSDAPALDSSL*

DNA
ATGGCGTACGAGAAAGTCAACGAGCTTAACCTTAAGGACACGGAGCTATGTCTTGGATTACCCGGAAGAACAGAGGAAAT
CAAAGAAGAACAAGAGGTTTCTTGCGTTAAAAGCAACAACAAGCGTCAATTTGAGGACACTCGTGAGGAAGAAGAATCTA
CACCTCCTACCAAAACTCAAATCGTTGGTTGGCCACCGGTGAGATCTTCCCGTAAGAACAACAACAGTGTGAGCTACGTG
AAAGTGAGTATGGACGGAGCTCCTTACCTCCGCAAGATCGATCTCAAGACATACAAAAACTACCCCGAGCTTCTCAAGGC
GTTAGAGAACATGTTCAAAGTCACGATAGGTGAATATTGTGAGAGAGAAGGATACAAAGGATCTGGATTTGTGCCTACAT
ACGAGGATAAAGATGGAGATTGGATGTTGGTTGGTGATGTTCCATGGGACATGTTCTCTTCATCTTGTAAGAGACTCAGA
ATCATGAAGGGTTCCGACGCTCCTGCTCTAGACTCTTCCTTATGA