Details for Lyrate rockcress Locus 16049981

Position : sca3 ( 5`- 1013985 .. 1017583 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049981

Protein [Map View]
MDAIRKQLDVLMGANRNGDVQEVNRKYYDRDVCRLYLSGLCPHDLFQLTKMDMGPCPKVHSLQLRKEYREAKAKGVDNYD
RELEDAIDRLIVECDRKIGRALKRLQEEDAKAAIAISVSEVTQSPEILELSEKIKEKMKEADIHDLEGKMDLKIRALELV
EEMRTKRADQQAVLLLEAFNKDRASLPQPAPAQPPSSALPTPDPRTQEMINEKLKKAEDLGEQGMVDEAQKALEEAEALK
KLTVRREPAADSTKYTAVDVRITDQKLRLCDICGAFLSVYDSDRRLADHFGGKLHLGYMLVRDKLTELLDEKANLRNERS
KERNSKERESSKDREKERGSSHERRRDYDRRSRDRDRHHDRDREQDKDYDRSHSRSRRRSRSRSRSRDRPRDYDRHRRHN
RY*

DNA
ATGGATGCCATAAGGAAGCAGCTCGATGTGCTCATGGGAGCGAATCGAAACGGCGACGTTCAGGAGGTGAATCGCAAATA
CTACGACCGTGATGTGTGTCGTCTTTACTTGTCTGGTCTCTGCCCTCACGATCTCTTCCAATTGACGAAAATGGATATGG
GACCTTGCCCTAAGGTGCACTCTTTGCAGCTTAGGAAAGAATATCGAGAAGCAAAGGCAAAAGGTGTTGATAACTACGAC
AGGGAATTGGAAGATGCCATAGACAGGCTTATCGTTGAGTGTGATAGGAAGATTGGTAGGGCCCTTAAGCGTCTTCAAGA
AGAGGACGCCAAAGCTGCCATTGCCATTTCAGTCTCTGAAGTCACTCAGTCACCTGAAATTCTCGAGTTATCGGAGAAAA
TCAAAGAGAAGATGAAGGAAGCAGATATCCACGATCTTGAAGGCAAAATGGATCTTAAGATTAGAGCTCTTGAGTTAGTC
GAAGAAATGAGGACCAAGAGAGCTGACCAGCAGGCGGTGCTGCTGTTGGAAGCCTTTAACAAAGATAGAGCATCCTTGCC
ACAGCCTGCTCCAGCTCAACCACCATCTTCCGCATTACCTACACCGGATCCTCGCACTCAAGAAATGATAAATGAGAAAC
TGAAGAAGGCAGAAGATCTTGGTGAACAAGGAATGGTTGATGAAGCACAGAAAGCACTGGAAGAGGCTGAAGCTCTTAAG
AAGCTTACAGTTAGACGAGAACCTGCAGCAGATTCAACGAAGTACACTGCTGTTGATGTGCGCATTACGGACCAAAAGTT
GCGTCTATGTGACATATGTGGAGCATTCTTGAGCGTCTATGACAGTGATCGCCGTTTAGCTGATCATTTTGGTGGGAAGC
TTCATTTAGGATACATGCTAGTCCGGGACAAATTAACTGAGCTTCTGGATGAGAAGGCCAATTTACGCAATGAAAGATCT
AAGGAACGGAACAGTAAGGAGAGGGAATCAAGTAAAGACCGAGAGAAAGAGCGAGGATCTAGTCATGAACGTCGAAGAGA
TTATGATCGCAGGAGTAGAGATCGAGATAGGCACCATGACCGTGATCGTGAACAAGACAAGGACTATGATCGGTCACACT
CAAGAAGCAGACGTAGGTCACGCTCACGGTCCAGGTCCAGAGACAGACCTAGGGACTATGATCGCCACAGGCGTCACAAC
CGATACTAG