Details for Lyrate rockcress Locus 16049967

Position : sca3 ( 5`- 699801 .. 698266 -3` )
Annotation : [B2G] trna synthetase class i family protein
External links : CoGe
PGDD synteny : 16049967

Protein [Map View]
MAYATGMTLASRSILPMCSRTFLSPLRVASLLVFPEKLSATFFRRVQVPHLFSTSTTPLFSSVKCSIQSTSSLETENQAV
SRPNVVDILEERGLLESITSENLRSACSDPKVAPLRVYCGFDPTAESLHLGNLLGIIVLSWFQRCGHQAVGLIGGATGRV
GDPSGKSLERPELDADTLEKNIAGIKRIIIKILGGNPSSGGSYVIFNNYDWWKDMTMLDFLNKVGRFARVGTMMAKESVK
KRLESEQGMSYTEFTYQLLQAYDFLHLFKNEGINVQIGGSDQWGNITAGTDLIRKILQAEEAAYGLTFPLLLKNDGTKFG
KSEDGAIWLSPSMLSPYKFYQYFFSVPDVDVIRFLKTLTFLSLDEIKILEDQMSKPGYVPNTAQIKLAEEVTRFVHGEEG
LKEAIKATEALRPGAETKLDWNLIERIAEDIPSCSLPIDRVSGLSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDD
ENKRVEEEDIVEGKGLVLSAGKKNKVVVRIS*

DNA
ATGGCATATGCAACAGGAATGACGCTTGCTTCAAGGAGTATCTTGCCTATGTGTTCCAGAACTTTCTTATCTCCCTTACG
TGTCGCTTCTTTACTCGTTTTTCCTGAGAAATTATCCGCAACTTTCTTCAGAAGGGTCCAAGTTCCTCACCTTTTCTCCA
CTTCTACTACTCCTCTGTTTTCCTCTGTTAAGTGCTCAATTCAATCTACTTCATCTCTTGAGACAGAAAATCAAGCTGTT
TCTCGCCCTAATGTTGTCGATATACTTGAAGAAAGAGGTCTCCTTGAGTCGATCACAAGCGAAAATCTCAGGTCAGCTTG
TTCTGATCCTAAAGTAGCTCCTCTAAGGGTCTACTGCGGGTTTGATCCAACGGCTGAGAGTTTACACTTAGGTAATCTAC
TTGGTATCATTGTGCTTTCTTGGTTCCAAAGATGTGGACATCAAGCTGTTGGTTTAATTGGTGGTGCCACGGGACGAGTT
GGTGACCCATCTGGTAAAAGCCTAGAAAGACCTGAACTTGACGCTGATACACTGGAGAAAAACATTGCCGGGATTAAAAG
AATCATTATCAAGATTCTGGGTGGCAATCCGAGTTCTGGTGGCTCTTACGTGATTTTTAATAACTATGACTGGTGGAAAG
ATATGACAATGCTCGACTTTCTGAACAAAGTCGGTAGGTTTGCTAGGGTTGGTACTATGATGGCAAAGGAGAGTGTGAAG
AAGAGATTAGAATCAGAACAAGGTATGAGCTACACCGAGTTCACTTATCAGTTATTGCAAGCCTATGATTTTCTTCACCT
GTTCAAGAACGAAGGGATCAATGTTCAGATAGGTGGTAGTGATCAATGGGGGAATATAACAGCTGGAACTGATTTGATCC
GGAAGATTCTCCAAGCAGAAGAAGCAGCTTACGGGCTAACATTTCCCCTTCTATTGAAAAACGATGGGACGAAATTCGGG
AAATCAGAAGATGGAGCAATCTGGCTATCTCCTTCGATGCTGTCGCCTTATAAGTTTTATCAGTACTTCTTCTCAGTTCC
AGACGTTGACGTGATACGTTTCTTAAAGACTCTAACTTTTCTGAGTTTGGATGAGATAAAGATCTTGGAAGATCAAATGA
GCAAACCCGGGTATGTTCCCAACACCGCACAAATCAAACTCGCTGAAGAAGTAACCAGATTTGTACATGGCGAAGAGGGC
TTGAAGGAAGCCATTAAAGCAACAGAAGCTTTAAGACCAGGAGCTGAGACAAAGCTTGATTGGAACTTGATTGAGAGAAT
AGCAGAGGATATACCTTCTTGCTCACTGCCCATTGATCGAGTGTCGGGTTTATCGATTGTGGATCTATCAGTTTCTGCGG
GTTTGTTTGAGAGCAAATCTGCTGCGAGGAGAATGTTGAAGCAAGGTGGGTTTTATATGAACAATGAGAGAGTTGATGAT
GAGAACAAGAGAGTTGAAGAAGAGGATATTGTTGAAGGGAAAGGTCTTGTTCTATCAGCAGGCAAGAAGAATAAAGTGGT
CGTTAGAATTTCCTGA