Details for Lyrate rockcress Locus 16049963

Position : sca3 ( 5`- 9690394 .. 9690167 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898636 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049963

Protein [Map View]
MGRKVMEKDQLTLFDLINAASYLDIQSLLDLACQTASDMSKAKTLDQTREFFNIENDFTPEEEKAVLKDYQKAFE*

DNA
ATGGGACGAAAAGTCATGGAAAAAGATCAATTAACGCTCTTTGATCTCATTAATGCTGCTAGTTACCTAGACATACAAAG
CCTTCTTGATCTAGCATGCCAAACTGCCTCGGATATGAGCAAAGCCAAAACTCTGGACCAGACTCGCGAATTCTTCAACA
TTGAGAATGATTTTACACCTGAGGAAGAAAAAGCTGTTCTTAAGGACTATCAAAAGGCTTTTGAATGA