Details for Lyrate rockcress Locus 16049950

Position : sca5 ( 5`- 17885821 .. 17888093 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049950

Protein [Map View]
MEVEKPELTLYNTMTQLKEVFKPINPGKIGMYVCGITAYDYSHIGHARAAVSFDLLYRYLRHLGYEVHYVRNFTDVDDKA
KKCGEKPLDLSNRFCEEYLLDMTALQCLIPTRQPRVSDHMEHIIKMIEKIIENGCGYAVGGDVFFSVDKSPSYGQLSGQR
LDHTQAGKRVAVDSRKRNPADFALWNAAKSGEPSWESPWGPGRPGWHIECSAMSAHYLSPRFDIHGGGADLKFPHHENEI
AQTCAACEDSGVNYWLHNGHVTNNNVKMGKSLDNFFTIREITAKYHPLALRHFLMSAQYRSPLNYSVSQLESSSDALYCA
YQTLEDLVKYLSPYREEMSGDVGKTQQTAEAKEMIKKVKNALKFINVSISKLKKIQKKQRMSLIVSLVEVEKAVREVLDV
LGLLTTLSYDEFLKEMKQKALTRAGIGEEEVLRRIDERKLARKNKDFKRSDQIRELLAAKGIALEDIPGKDTVWRPCTPL
SLNPV*

DNA
ATGGAGGTGGAGAAACCGGAGTTGACATTGTATAACACGATGACTCAGTTGAAAGAAGTTTTTAAGCCGATCAATCCCGG
CAAGATCGGGATGTATGTCTGTGGCATCACCGCCTACGATTATAGCCATATTGGGCACGCTCGTGCCGCCGTCTCTTTTG
ACCTCCTTTACAGGTACTTAAGGCACTTGGGTTATGAAGTTCATTATGTCAGAAATTTTACAGATGTTGATGACAAGGCT
AAAAAGTGTGGGGAGAAGCCGTTAGATTTGAGTAATCGCTTTTGCGAGGAGTATCTTCTAGATATGACTGCTCTTCAGTG
CCTCATTCCCACCCGCCAGCCTCGTGTCAGTGACCATATGGAGCACATTATTAAGATGATTGAAAAGATCATTGAAAACG
GATGTGGCTATGCAGTGGGTGGAGATGTGTTCTTCTCAGTGGATAAGTCACCGAGTTACGGTCAATTATCTGGGCAACGG
TTGGATCATACTCAAGCTGGTAAGCGTGTTGCTGTTGACTCAAGGAAGCGCAATCCTGCCGACTTTGCATTATGGAACGC
TGCAAAATCTGGTGAACCAAGTTGGGAGAGCCCTTGGGGTCCAGGAAGACCAGGATGGCACATCGAGTGCAGCGCCATGA
GTGCTCATTACCTGTCTCCGAGATTTGACATTCATGGTGGTGGCGCAGATCTGAAATTCCCGCACCATGAAAATGAGATC
GCCCAGACATGTGCTGCTTGTGAAGATAGTGGTGTGAATTACTGGTTGCATAATGGGCATGTTACCAACAACAATGTGAA
GATGGGAAAATCACTGGACAACTTCTTTACGATTAGAGAAATCACGGCAAAATATCATCCACTGGCTCTAAGACACTTCT
TGATGAGTGCACAGTACCGTTCTCCTCTGAACTATTCGGTTTCGCAGCTTGAGAGTTCATCGGATGCTTTATATTGTGCT
TATCAGACATTAGAAGATCTTGTTAAATATCTATCGCCATATCGAGAAGAAATGAGTGGAGATGTGGGAAAGACTCAACA
GACTGCAGAAGCCAAAGAGATGATAAAGAAGGTGAAAAACGCATTGAAATTCATCAACGTTTCAATCTCCAAGCTCAAGA
AAATTCAGAAAAAGCAGCGGATGTCGCTGATCGTATCACTAGTCGAGGTTGAGAAAGCAGTGAGGGAAGTTCTTGATGTG
CTTGGTTTGCTCACGACTCTAAGCTACGACGAGTTTTTGAAAGAGATGAAACAAAAGGCATTAACAAGAGCAGGAATAGG
AGAAGAAGAGGTCTTGCGGAGGATCGACGAAAGGAAATTAGCCCGAAAGAATAAAGATTTCAAGAGAAGCGATCAAATTA
GAGAGTTGTTGGCAGCTAAAGGAATCGCCCTGGAGGATATTCCTGGAAAAGACACGGTGTGGAGACCATGCACCCCTTTG
AGCCTAAATCCGGTTTAG