Details for Lyrate rockcress Locus 16049944

Position : sca3 ( 5`- 10703446 .. 10702298 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_342480 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049944

Protein [Map View]
MGFLDLPFMLKAFQFRRLVVEDGRRRKKNKPSWLTPVSHGFYTVDRLSNIDNSSNDDSVFVQREQHSEELEIWFFGVSKA
ERGKEIVKYMQNHLFDKLPNELGIMRKCKETMRGAYVEEERTGGSAASVMVVNGEKLAMASIGGHRVVVCRDGEAHQIRD
KNLKSSKHWSQFIFPVCNQEDLEDESDQRNSELVVITEKINTDTEFIIIGSSGIWEVMKNQEAINLIRHIEDPKEAAKCL
AKEALNRISKSSISCVVIRFD*

DNA
ATGGGCTTCTTAGATCTCCCTTTCATGCTCAAGGCGTTCCAATTTAGACGACTTGTAGTTGAGGATGGAAGGAGAAGGAA
GAAGAATAAACCATCATGGTTAACTCCGGTTTCTCATGGATTCTATACCGTTGACCGGTTAAGCAATATCGACAATTCAT
CGAATGATGATTCGGTTTTTGTACAAAGAGAGCAACACAGTGAAGAGCTTGAGATTTGGTTCTTTGGAGTTTCGAAAGCT
GAAAGAGGGAAAGAGATTGTCAAATATATGCAAAACCATCTCTTTGATAAGCTCCCCAATGAGCTCGGAATTATGAGAAA
GTGTAAAGAGACAATGAGAGGAGCGTACGTGGAGGAAGAGAGAACCGGTGGCTCAGCCGCTTCGGTTATGGTGGTGAACG
GAGAAAAGCTAGCCATGGCGAGTATCGGGGGCCATAGAGTAGTGGTTTGCAGAGACGGCGAGGCTCATCAAATCAGAGAT
AAAAACCTGAAATCCTCAAAACATTGGTCACAATTTATTTTCCCAGTTTGTAATCAAGAAGATTTAGAAGATGAATCAGA
TCAAAGAAATTCAGAACTTGTAGTGATTACAGAGAAGATTAATACAGATACAGAGTTTATCATTATCGGTAGCTCTGGAA
TTTGGGAGGTTATGAAGAATCAAGAAGCGATTAATCTAATCAGACACATAGAAGATCCTAAAGAAGCTGCAAAATGTTTA
GCTAAAGAAGCTTTAAACAGGATTAGCAAAAGCAGCATTTCTTGCGTTGTAATTCGGTTTGACTAA