Details for Lyrate rockcress Locus 16049941

Position : sca3 ( 5`- 8425495 .. 8423958 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049941

Protein [Map View]
MGDTAEDQNDRAMMEAEGVTSFSELLMFSDGVLSSSSDHQREGNVGDRGEDSLGFVFSGKTGSRMLCFSGGYQNDDESLF
LEPSVPSLGVSVLDPSCIKIDSKNSNDACTVDKSPKSSNKKRTGTGNGQEPDQNRKPDKKCKRNQDKSSVGIAKVRKERL
GERIAALQQLVSPYGKTDAASVLHEAMGYIKFLQDQIQVLCSPYLINHSLDGGVVTGDVMAAMKAKDLRSRGLCLVPVSS
TVHVENSNGADFWSPVTMGHTTSQSLPHGF*

DNA
ATGGGAGATACCGCAGAGGATCAGAACGACCGAGCTATGATGGAAGCTGAAGGAGTCACGAGCTTCTCCGAACTTCTTAT
GTTCTCTGACGGCGTTCTCAGCTCCTCCTCCGACCACCAACGTGAGGGTAATGTCGGCGATCGTGGAGAAGACAGCTTGG
GTTTTGTATTCTCCGGCAAAACTGGCTCAAGAATGCTCTGTTTTAGCGGAGGATATCAAAACGACGACGAGTCACTCTTC
CTAGAACCTTCTGTTCCCTCCTTGGGAGTCTCTGTTCTTGACCCTTCATGCATTAAGATCGATTCCAAGAACTCAAACGA
CGCGTGTACGGTCGATAAATCACCTAAATCATCAAACAAGAAGAGAACCGGAACGGGTAATGGGCAAGAGCCAGATCAAA
ATCGAAAACCGGACAAGAAATGCAAGCGAAATCAGGATAAATCATCAGTTGGAATTGCAAAGGTCAGGAAAGAAAGGTTA
GGGGAAAGAATTGCAGCGTTGCAGCAGTTGGTTTCTCCATACGGCAAGACAGATGCAGCTTCTGTGTTGCATGAAGCGAT
GGGTTACATCAAATTCTTACAGGATCAGATTCAAGTCCTTTGCTCTCCTTATCTAATCAACCATTCTCTTGACGGTGGAG
TTGTCACCGGAGATGTAATGGCGGCGATGAAAGCTAAAGACTTGAGAAGCAGAGGATTATGTCTAGTACCTGTCTCATCC
ACCGTACACGTGGAAAACTCCAACGGTGCTGATTTCTGGTCACCTGTTACTATGGGTCACACTACGTCACAGTCACTGCC
TCACGGATTTTAA