Details for Lyrate rockcress Locus 16049909

Position : sca3 ( 5`- 5464001 .. 5465461 -3` )
Annotation : [B2G] transcription factor iid-1
External links : CoGe
PGDD synteny : 16049909

Protein [Map View]
MADQGLEGSTPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMV
CTGAKSEYFSKMAARKYARIVQKLGFSAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKI
VLLIFVSGKIVITGAKMREETYRAFENIYPVLTEFRKIQQ*

DNA
ATGGCTGATCAAGGATTGGAAGGGAGTACTCCAGTGGACCTTAGCAAGCATCCTTCAGGGATTGTTCCTACTCTTCAAAA
CATTGTCTCCACGGTGAACCTAGACTGCAAGCTAGATCTTAAAGCCATAGCTTTGCAGGCTCGGAATGCTGAATATAATC
CCAAGCGTTTTGCTGCTGTTATAATGAGGATCAGAGAACCGAAGACTACAGCATTGATATTCGCCTCAGGGAAAATGGTC
TGTACTGGAGCGAAGAGCGAGTACTTTTCGAAGATGGCTGCCCGAAAGTATGCTAGGATTGTGCAGAAATTGGGATTCTC
TGCAAAATTCAAGGATTTCAAGATTCAGAATATCGTAGGTTCTTGTGATGTCAAATTCCCTATAAGACTTGAAGGTCTTG
CTTACTCTCACGCTGCTTTCTCAAGTTATGAGCCCGAGCTCTTCCCAGGGCTGATTTATAGGATGAAAGTGCCTAAAATC
GTCCTTCTAATCTTTGTCTCTGGGAAGATCGTTATAACGGGAGCCAAGATGAGAGAGGAGACTTACAGAGCCTTTGAGAA
TATATACCCCGTGCTCACGGAATTCAGAAAGATACAGCAATAG