Details for Lyrate rockcress Locus 16049877

Position : sca3 ( 5`- 6876053 .. 6876676 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049877

Protein [Map View]
MEKNVSISKKLGNIVRFVLYMIHKGISKQKLLADFNATLKRGKNLMLHNRRRFPATASAVASHPQKEYEFSCSDTPNYIF
PFNMAAFKKKSHHNSLFSCGHAPPTLDDDTSVSRAVLELLNSGGDHDQGSNTPALSVEALTALSPYLPVFGRSTPSVRPL
RVTDSPFPLREDGDVSNGYVDKAADEFIKKFYKNLNQQKKMIESSPN*

DNA
ATGGAGAAGAATGTATCAATAAGCAAGAAGCTAGGGAACATTGTACGTTTTGTCTTGTACATGATACACAAAGGCATTTC
AAAGCAAAAGCTCCTTGCCGACTTTAATGCCACTCTCAAACGCGGCAAGAATCTCATGCTCCACAACCGCCGCCGTTTCC
CAGCCACCGCCTCCGCTGTTGCGTCCCATCCGCAGAAAGAGTACGAGTTTAGTTGCAGCGACACTCCCAACTACATATTC
CCCTTTAACATGGCCGCCTTCAAGAAGAAGAGCCACCACAACAGTCTTTTCTCGTGTGGTCACGCGCCACCGACCCTTGA
CGACGACACTTCCGTCTCCAGAGCCGTCCTAGAGCTTCTCAACAGCGGCGGAGATCATGATCAGGGAAGTAACACCCCAG
CTTTGTCAGTCGAGGCCTTGACGGCGTTATCTCCTTACTTGCCGGTGTTTGGACGGAGTACTCCGTCAGTGAGGCCCTTA
CGGGTAACGGACTCACCGTTTCCGTTACGGGAAGATGGTGACGTGTCTAACGGATACGTGGACAAAGCAGCGGATGAGTT
TATAAAGAAGTTTTACAAGAACTTGAATCAGCAAAAGAAGATGATCGAGTCCTCACCTAATTAA