Details for Lyrate rockcress Locus 16049865

Position : sca3 ( 5`- 8816827 .. 8817874 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049865

Protein [Map View]
MKGPPVTCVFGVNIGLKGYQKMLNKIYEGIEGLKLDVSNWLVYLRGEIDPIIFIKKLYKARSYIELFRIDYGYEENPEGT
RRPSSHFMRCCFELNTSDISWYKRIIGALKTIQGVSFTIDAQPVMGYPMAYVCGNIEIGVLMRMLVKTGIELSAMEYGVE
YKDANLNPPPPKKPEAPSNVTETQPVKDTVPPPLEVVSTLAKHQVIYKKPRGFRRFCC*

DNA
ATGAAGGGTCCTCCAGTGACATGTGTGTTTGGTGTGAATATTGGACTCAAGGGTTATCAAAAGATGTTGAATAAAATATA
TGAGGGCATTGAAGGTTTAAAGCTCGATGTGTCAAACTGGTTGGTGTATTTACGGGGCGAAATTGATCCTATAATCTTCA
TCAAGAAGCTGTATAAAGCGAGAAGTTACATTGAGCTCTTCCGAATAGATTATGGATATGAAGAGAATCCAGAAGGAACC
CGGAGACCAAGTTCTCACTTCATGAGATGTTGCTTTGAACTAAACACATCAGATATAAGTTGGTATAAGAGAATCATAGG
AGCTTTGAAGACCATCCAAGGTGTATCATTTACCATAGATGCACAACCAGTTATGGGATATCCGATGGCATATGTATGTG
GAAATATAGAAATTGGAGTGCTCATGAGGATGCTTGTGAAGACAGGCATTGAACTATCAGCAATGGAATATGGAGTCGAG
TATAAAGATGCAAACTTGAACCCACCTCCTCCCAAGAAACCTGAGGCTCCTTCAAATGTAACTGAGACACAGCCCGTGAA
AGACACGGTGCCTCCTCCTCTTGAAGTTGTTAGTACATTAGCGAAACACCAAGTCATATACAAGAAGCCTCGCGGTTTTA
GAAGGTTCTGTTGTTAA