Details for Lyrate rockcress Locus 16049838

Position : sca3 ( 5`- 4226153 .. 4228764 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897238 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049838

Protein [Map View]
MLTMEKEFDSKLSLQGNSSSNGATISRSKSFAFKAPQENFTYHDFELGKIYGVGSYSKVVRAKKKDNGTVYALKIMDKKF
ITKENKTAYVKLERIVLDQLEHPGIVKLFFTFQDTQSLYMALESCEGGELFDQITRKGRLSEDEARFYSAEVVDALEYIH
NMGLIHRDIKPENLLLTSDGHIKIADFGSVKPMQDSQITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALG
CTLYQMLSGTSPFKDASEWLIFQRIIARDIKFPNHFSEAARDLIDRLLDTDPSRRPGAGSEGYASLKRHPFFKGVDWKNL
RSQTPPKLAPDPASQSASPERDGSPWNPTHVGDTSVLQNDGHNGLSESSGSITRLASIDSFDSRWQQFLEPGESVLMISA
VKKLQKITSKKVQLILTNKPRLIYVDPSKLVVKGNIIWSDNSNDLNVQVSSPSHFKICTPKKVLSFEDAKQRALQWKKAI
ETLQNR*

DNA
ATGTTGACAATGGAGAAGGAATTTGATTCAAAGCTTTCTCTTCAAGGGAATTCATCTTCTAATGGTGCAACTATTTCCAG
AAGCAAAAGTTTCGCCTTTAAGGCTCCTCAGGAGAATTTCACCTACCATGATTTCGAGCTCGGCAAGATCTATGGCGTTG
GCTCTTATTCAAAGGTTGTTAGGGCGAAGAAGAAGGATAATGGAACTGTGTATGCCTTAAAGATCATGGACAAAAAGTTT
ATCACCAAGGAGAATAAAACAGCTTATGTCAAATTGGAGAGGATTGTTCTTGATCAACTCGAACATCCCGGGATTGTGAA
ACTCTTCTTTACTTTTCAAGATACACAATCACTATACATGGCGCTTGAATCTTGCGAAGGTGGGGAACTTTTCGACCAAA
TCACCAGAAAAGGTCGTCTATCTGAGGATGAAGCTCGGTTCTACAGTGCAGAAGTTGTGGACGCTCTTGAGTATATACAT
AATATGGGACTGATACATCGAGATATCAAGCCAGAGAATCTGTTGTTAACTTCAGATGGACATATTAAGATTGCCGATTT
TGGTAGCGTAAAGCCAATGCAAGACAGCCAAATCACAGTGCTGCCTAATGCGGCTTCCGATGATAAGGCGTGCACTTTTG
TCGGGACGGCTGCATATGTTCCTCCTGAAGTTCTAAACTCCTCCCCAGCAACTTTCGGAAATGATCTCTGGGCACTCGGC
TGCACTCTGTACCAAATGCTTTCAGGAACTTCCCCATTCAAGGATGCAAGTGAATGGCTAATTTTCCAAAGAATCATAGC
TAGAGATATAAAGTTTCCAAATCATTTCTCAGAAGCAGCAAGAGACCTCATCGACCGATTGCTAGATACAGATCCTAGTA
GAAGACCAGGAGCTGGATCAGAAGGTTATGCTTCTCTCAAGAGACATCCTTTCTTCAAGGGAGTTGACTGGAAGAACCTA
AGGTCACAAACTCCTCCAAAACTAGCTCCAGATCCTGCGTCTCAATCAGCATCTCCTGAAAGGGACGGTTCTCCATGGAA
CCCAACACATGTTGGAGATACCTCAGTTTTGCAGAACGATGGACACAACGGACTCTCTGAGTCCTCAGGTTCCATAACTC
GGCTTGCCTCCATAGACTCTTTTGATTCGAGATGGCAACAGTTTCTAGAACCGGGAGAATCGGTTCTAATGATATCAGCA
GTGAAGAAGCTACAGAAAATCACAAGTAAGAAGGTGCAGCTAATACTCACCAACAAACCAAGACTGATATACGTTGACCC
ATCAAAGCTTGTAGTAAAAGGGAACATTATCTGGTCTGATAACTCCAACGACCTCAACGTTCAAGTCTCAAGTCCTTCCC
ATTTCAAGATTTGCACACCGAAGAAAGTTTTATCGTTTGAAGATGCGAAACAAAGAGCTTTGCAGTGGAAAAAGGCAATC
GAAACTCTTCAAAACCGTTGA