Details for Lyrate rockcress Locus 16049819

Position : sca3 ( 5`- 8525692 .. 8527341 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049819

Protein [Map View]
MDPCSFVRIIVGNLAVRFQSSSSSSSGPSVSGINPSAPNCYCKIRFKNFPREIVSIPVMFRTESESETRSSSGNVSTVAA
CFSLSKAQIEASLKKPKLSVLSVEAFSRGNCDGDDGVSGASCGLATAGEKLLGRFEVSLDLKSAETKSCLAHNGWVALPS
KKSKSKSGSDPELHVSVRVEPDPRFVFQFDGEPECSPQVFQVQGNTKQAVFTCKFGSRNSNSGDRNLLHSSSMMSESSST
RSCISSMNSEKEQPSKERKGWSITVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGCTWKPWGRLEAWRE
AGYSDTLGYRFELFQDGIATAVSASSSISLKNGGSFVIDVTGGTTTTASTPTTSPQGSWDLGSGSSADSRPASRPGSGSG
SDFGYLLPQHPSSAAAQNRGFVMSATVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSHKLRKELR
QQSQLGVV*

DNA
ATGGATCCGTGCTCTTTCGTACGGATCATCGTCGGTAACTTGGCCGTTAGGTTTCAGTCATCGTCTTCTTCCTCATCAGG
ACCGTCTGTTTCCGGTATCAATCCGTCGGCTCCTAACTGTTACTGCAAAATCAGATTCAAGAATTTTCCTCGCGAGATTG
TTTCTATTCCGGTTATGTTTCGAACTGAATCTGAATCCGAGACTCGTTCTTCCTCCGGTAACGTCTCTACCGTCGCTGCT
TGTTTCAGTTTAAGTAAAGCTCAGATCGAAGCGTCTTTGAAGAAACCTAAGTTGAGTGTTCTCTCCGTTGAGGCTTTTTC
CCGCGGAAACTGCGACGGTGACGACGGTGTTAGCGGCGCGTCGTGTGGACTCGCTACGGCGGGGGAGAAGTTGCTTGGTC
GATTTGAGGTTTCGTTGGATTTGAAATCGGCGGAGACGAAGAGTTGTTTGGCGCATAACGGTTGGGTTGCTTTGCCGTCT
AAGAAATCGAAGAGTAAATCTGGATCCGATCCGGAGCTCCACGTTAGTGTTCGGGTCGAACCTGACCCGAGATTCGTGTT
TCAGTTTGACGGCGAGCCTGAGTGTAGTCCTCAGGTTTTTCAGGTTCAAGGAAACACGAAGCAAGCCGTGTTCACTTGCA
AGTTCGGCTCCAGAAACTCCAACTCCGGTGATCGGAATCTTCTTCACAGTTCTTCGATGATGTCTGAGTCAAGCTCAACG
AGAAGTTGTATATCGTCGATGAATTCGGAAAAAGAACAACCGTCAAAAGAGAGAAAAGGATGGTCAATAACAGTCCATGA
TCTTTCCGGTTCACCCGTGGCTATGGCCTCTATGGTTACACCTTTCGTTCCATCTCCTGGTTCGAACCGGGTCACTCGAT
CAAGTCCCGGAGCGTGGCTTATTCTTCGACCTGACGGTTGCACATGGAAGCCATGGGGAAGACTAGAGGCGTGGCGTGAA
GCTGGTTACTCCGACACACTCGGTTACCGTTTCGAGCTTTTCCAAGACGGTATCGCCACAGCCGTCTCCGCATCTTCGTC
TATCAGTTTGAAAAATGGAGGGAGTTTCGTTATCGATGTTACCGGCGGGACAACCACGACGGCGTCAACGCCGACGACGA
GTCCTCAAGGAAGCTGGGATCTCGGATCCGGTTCAAGCGCGGATTCGAGACCCGCGTCGAGACCAGGATCAGGATCCGGG
TCGGATTTCGGATATTTACTACCGCAACATCCGTCGTCTGCGGCGGCGCAAAACAGAGGGTTCGTTATGTCGGCTACGGT
TGAAGGAGTTGGGAAACGAAGCAAACCGGAAGTAGAAGTCGGTGTGACGCACGTGACATGTACGGAGGATGCAGCAGCGC
ACGTGGCATTAGCTGCGGCGGTCGATCTGAGTTTGGATGCTTGCAGGCTTTTCTCACACAAGCTAAGGAAAGAGCTGAGA
CAGCAAAGCCAGCTTGGTGTCGTTTGA