Details for Lyrate rockcress Locus 16049816

Position : sca3 ( 5`- 7098593 .. 7099507 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479140 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049816

Protein [Map View]
MNTNDPDPIPFNRPEDNISGSKTYAMSGKIMLSAIVILFFVVILMVFLHLYARWYLLRARRRHLRRRSRNRRATMVFFTA
DPSTAATSVVASRGLDPNVIKSLPVFTFSDETHKDPIECAVCLSEFEESESGRVLPNCKHTFHVDCIDMWFHSHSTCPLC
RSLVEPLAGIELMEATTEGEVVIAIGSDPVSAIEPGSSSGLRDEPHGSGSSPMPTEDSGRKPAAIEVPRRNFSEFEDELT
RRDSPASQSFRSPMSRMLSFTRMLSRDRRSASSPIAGAPPVSPSLSCRIQMTESDIEQGGEESR*

DNA
ATGAACACCAACGACCCGGATCCGATTCCGTTTAACAGACCCGAAGACAACATCTCCGGTTCTAAAACCTACGCCATGAG
CGGCAAAATCATGCTAAGCGCTATAGTAATCCTCTTCTTCGTCGTCATTTTAATGGTCTTCCTCCATCTTTACGCTCGTT
GGTATCTCCTCCGTGCTCGTAGGCGTCATCTCCGTCGTCGTAGCCGTAACCGTCGCGCTACGATGGTTTTCTTCACCGCT
GATCCTTCCACCGCCGCCACTTCCGTCGTTGCTTCACGTGGACTTGATCCAAACGTCATTAAATCTCTACCCGTTTTCAC
TTTCTCCGATGAGACTCATAAAGATCCGATCGAATGCGCCGTTTGTTTGTCGGAATTTGAAGAGAGCGAATCGGGTCGGG
TTTTGCCCAATTGTAAACATACTTTTCATGTTGATTGTATTGATATGTGGTTTCATTCTCATTCCACTTGTCCTCTTTGT
CGCTCTCTCGTTGAGCCTCTCGCCGGAATTGAATTAATGGAGGCGACGACGGAGGGGGAAGTTGTGATTGCGATTGGTTC
TGATCCGGTTTCTGCAATTGAACCGGGTTCTAGCTCTGGATTGAGGGATGAACCACATGGATCTGGATCTTCTCCGATGC
CGACGGAAGATTCCGGGAGAAAACCGGCGGCGATTGAGGTTCCGAGGAGGAATTTCAGCGAGTTCGAAGACGAGTTGACT
CGGAGAGACTCGCCGGCGAGTCAGTCGTTTAGATCGCCGATGAGTCGGATGTTATCTTTTACTCGGATGTTGAGTAGAGA
TAGAAGAAGCGCTTCGTCTCCTATCGCCGGAGCTCCGCCGGTATCTCCGTCGTTGAGTTGCCGGATACAGATGACCGAGT
CAGATATCGAGCAGGGAGGAGAAGAGAGTAGGTGA