Details for Lyrate rockcress Locus 16049812

Position : sca3 ( 5`- 3250044 .. 3246947 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478110 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049812

Protein [Map View]
MGRSKLASRPAEEDLNTGKSKRKKISSGPENAGASVSTGSEAGNERKAGFYCCNYCDKDLSGLVRFKCAVCMDFDLCVEC
FSVGVELNRHKNSHPYRVMDNLSFPLVTSDWNADEEILLLEAIATYGFGNWKEVADHVGSKTNTECIDHFNSAYMQSPCF
PLPDLSHTIGKSKEELLAMSKESAVRTELPALVRLSPKEELPMSAEIKHEASGKDNAIDPPLPALAGVKKKVNVPQAKDI
KLEAAKQQSDRSVGEKKLRLPGEKVPLVTELYGYNLKREEFEIEHDNDAEQLLADMEFKDSDTDAEREQKLQVLHIYSKR
LDERKRRKEFVLERNLLYPDQYEMSLSAEERKIYKSCKVFARFHSKEEHKELIKKVIEEHQILRRIQDLQEARTAGCRTT
SEANRFIEEKRKKEAEESVLLRLNHGAPGSIAGKTLKSPRGLPRNLQPFGSDSLPKVTPPIIYSGLDTWDVDGLLGADLL
SETEKKMCNETRILPVHYLKMLDILTSEIMKGQIKKKSDAYSFFKVEPSKVDRVYDMLVQKEIGEST*

DNA
ATGGGTCGTTCGAAATTAGCTTCTCGTCCTGCTGAAGAAGACCTGAATACAGGAAAATCGAAAAGGAAAAAGATATCTTC
GGGTCCTGAGAATGCAGGGGCTTCAGTTTCCACCGGAAGTGAAGCTGGGAATGAGAGGAAAGCTGGCTTTTATTGTTGTA
ACTATTGCGATAAAGATCTGTCTGGTTTGGTTCGTTTCAAATGTGCTGTTTGTATGGACTTTGACCTTTGTGTGGAATGC
TTTTCTGTCGGCGTTGAACTTAATCGTCACAAGAACAGTCACCCATATCGGGTTATGGACAATTTGTCTTTTCCTCTTGT
TACTTCTGATTGGAATGCCGATGAAGAGATACTCCTTCTTGAGGCCATTGCCACATACGGGTTTGGCAATTGGAAAGAAG
TTGCAGACCATGTTGGCAGTAAGACAAATACAGAATGTATTGATCACTTCAATTCTGCTTACATGCAGTCACCATGCTTT
CCACTTCCGGACTTGTCCCATACAATTGGAAAGAGCAAAGAGGAGCTGCTTGCTATGAGTAAAGAGAGTGCAGTCAGAAC
AGAATTACCTGCACTTGTGAGGCTATCTCCAAAAGAAGAGTTGCCTATGTCAGCTGAAATCAAACACGAAGCTTCAGGGA
AGGACAATGCAATAGATCCACCTTTGCCTGCCTTAGCTGGAGTCAAGAAGAAAGTCAATGTACCGCAGGCTAAGGACATC
AAGTTGGAAGCTGCAAAACAACAATCTGACAGGAGTGTCGGGGAGAAGAAACTCAGACTTCCTGGAGAGAAAGTTCCATT
AGTAACAGAGTTGTATGGTTACAATCTAAAGAGGGAAGAATTTGAGATCGAACATGACAACGATGCTGAGCAACTGCTCG
CAGACATGGAATTTAAGGATTCTGACACGGATGCTGAGCGTGAGCAGAAGCTGCAGGTGCTTCATATTTACTCGAAAAGG
CTTGATGAGAGGAAGCGGAGGAAGGAATTCGTTCTGGAAAGAAACTTGTTGTACCCTGATCAATATGAGATGAGCCTTTC
AGCAGAGGAGAGAAAAATATATAAAAGTTGTAAAGTCTTTGCGCGGTTCCACTCCAAAGAAGAGCACAAGGAACTGATTA
AGAAAGTCATTGAGGAGCACCAAATTCTCAGAAGAATCCAGGATCTTCAGGAAGCTAGAACTGCTGGTTGTAGGACAACA
TCAGAAGCAAATAGATTTATAGAAGAGAAGAGAAAGAAGGAAGCTGAAGAAAGTGTGCTGCTGCGACTAAACCATGGTGC
ACCAGGCAGTATAGCCGGTAAAACATTAAAAAGTCCAAGAGGGTTACCCAGAAATTTGCAGCCCTTTGGTTCTGACTCAC
TGCCAAAGGTCACACCTCCAATAATATATAGCGGTTTGGACACTTGGGATGTTGATGGTCTCCTTGGAGCTGACTTGCTC
TCTGAGACCGAAAAAAAGATGTGCAATGAGACCAGAATACTGCCTGTACACTATTTGAAGATGTTGGATATCTTAACAAG
CGAAATAATGAAGGGGCAGATAAAGAAAAAGTCTGATGCTTATAGCTTCTTCAAAGTAGAGCCGAGTAAAGTAGACAGAG
TATATGATATGCTGGTTCAGAAGGAAATAGGTGAGTCAACATGA