Details for Lyrate rockcress Locus 16049805

Position : sca2 ( 5`- 16499535 .. 16496142 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476635 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049805

Protein [Map View]
MVGASSSYASPLCTWFVAACMSVSHGGGDTRQAVALQSAGRSRRRRQLSKCSSASGSASIQALVTSCLDFGPCTHYNNNN
NNALSSLFGSNSVSLNRNQRRLNRAASSGGAMAVMEMEKEAMVNKKPPTEQRRVVVTGMGVETSLGHDPHTFYENLLQGN
SGISQIENFDCSEFPTRIAGEIKSFSTEGWVAPKLSKRMDKFMLYLLTAGKKALADGGVTDDVMAEFDKTKCGVLIGSAM
GGMKVFYDAIEALRISYKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILNSANHIIKGEADVMLCGG
SDAVIIPIGLGGFVACRALSQRNNDPTKASRPWDTNRDGFVMGEGAGVLLLEELEHAKKRGATIYAEFLGGSFTCDAYHM
TEPHPDGAGVILCIERALASAGVSKEQINYINAHATSTHAGDIKEYQALAHCFGQNPELKVNSTKSMIGHLLGAAGAVEA
VATVQAIRTGWVHPNINLENPDSGVDTKLLVGPKKERLDIKAALSNSFGFGGHNSSIIFAPYK*

DNA
ATGGTGGGTGCGTCTTCCTCCTACGCATCTCCGTTATGTACCTGGTTTGTTGCAGCTTGCATGTCCGTCTCTCACGGCGG
TGGAGATACCCGTCAGGCTGTTGCTCTTCAATCTGCTGGGCGGAGTCGGCGAAGGAGGCAGCTTAGCAAATGCTCCTCCG
CTTCTGGATCCGCTAGCATTCAGGCTCTCGTCACTTCTTGTTTGGATTTTGGTCCCTGTACTCACTACAACAACAACAAC
AACAATGCATTGTCTTCTCTCTTTGGATCGAATAGTGTTTCTTTGAATCGAAACCAGAGGAGACTGAATCGTGCAGCTAG
CTCTGGTGGAGCCATGGCAGTGATGGAGATGGAGAAGGAAGCCATGGTTAACAAGAAACCACCTACGGAGCAGCGTCGTG
TTGTAGTGACAGGCATGGGAGTTGAAACATCATTGGGTCATGACCCTCATACCTTTTATGAGAATTTGCTACAAGGCAAT
AGTGGTATTAGCCAGATTGAGAATTTTGATTGTTCTGAATTTCCTACGCGAATTGCGGGTGAGATCAAAAGCTTCTCGAC
TGAAGGATGGGTTGCTCCAAAACTTTCTAAAAGGATGGACAAGTTCATGCTCTATCTTCTCACAGCTGGCAAGAAAGCTT
TGGCTGATGGTGGGGTAACTGATGATGTAATGGCAGAGTTTGACAAAACCAAATGTGGAGTTTTGATTGGCTCGGCAATG
GGAGGAATGAAGGTCTTTTATGACGCTATTGAAGCTCTGAGAATCTCTTACAAGAAGATGAATCCCTTTTGTGTACCTTT
TGCGACAACAAACATGGGTTCTGCTATGCTTGCTATGGATCTGGGATGGATGGGGCCAAACTATTCTATTTCAACTGCTT
GTGCCACAAGCAACTTTTGCATTCTGAATTCAGCAAACCACATTATTAAAGGTGAAGCTGATGTAATGCTCTGTGGTGGC
TCAGATGCAGTTATTATTCCAATAGGGTTGGGAGGTTTTGTTGCATGCCGGGCTCTTTCACAAAGGAATAATGATCCAAC
AAAAGCTTCACGTCCTTGGGATACCAATCGAGATGGTTTCGTGATGGGAGAGGGAGCTGGAGTTCTACTTTTGGAAGAAC
TCGAGCATGCTAAGAAAAGAGGAGCAACTATCTACGCAGAGTTCCTCGGTGGGAGTTTCACATGTGATGCGTATCACATG
ACTGAGCCTCACCCTGATGGGGCTGGTGTCATTCTCTGTATCGAGAGAGCGTTAGCTAGTGCTGGGGTTTCCAAGGAACA
GATAAATTACATAAATGCACATGCAACCTCAACACACGCTGGAGATATCAAGGAGTACCAAGCCCTTGCTCACTGTTTTG
GCCAAAATCCTGAGCTTAAGGTAAATTCCACAAAGTCTATGATTGGACACTTGCTGGGAGCTGCTGGGGCCGTGGAAGCT
GTTGCAACCGTGCAGGCAATAAGGACCGGATGGGTTCATCCAAATATCAACCTCGAGAATCCAGACAGTGGAGTGGATAC
AAAGCTGCTGGTGGGTCCTAAGAAGGAGAGATTGGACATTAAAGCAGCCTTGTCAAATTCTTTCGGGTTTGGTGGTCATA
ACTCCAGCATCATTTTTGCTCCTTACAAGTGA