Details for Lyrate rockcress Locus 16049803

Position : sca3 ( 5`- 7998229 .. 7995975 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898233 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049803

Protein [Map View]
MEMSGLGRKRLSKWDSKEDTHHHHSTVNANSGSYYRDNESEPIRFNAESNGEARTRSRVSQNNDNSYFSEQDDTRQQFFP
RSGSRSNSSSRSRSRSPVYRGRRDAGSYDRHKTRTQVSPTPIREFNKRGSDHQFDQRSDYGWEDNIRKPRETKYHTENIR
EEAMMEGARSSDYNTDYPEDNSRREHVNDGGLDPRMRRHRSEFMGEKETQRRGGDGEGGFHRSSNIPCKFFAAGTGFCRN
GNYCRFSHHVADRKQPQDNNFYRQDKKNHSSGHNKWNDVERLDNGRVGRIEDSRASKGVSESKGNGSSWIGDMEMSPDWN
YGVQALKKPVKEEHGVGIIGPSSQSRVLKDDLVTNYDQRNSGMFSHGDKTMAEKPIAASHQSYSNSVNVAPVQAFNQNHN
VLPYQSSLTTGGSQQVVAAATNFSVGSNLSNLESGKVYQDNHHSMVEKPVLVQNTVSREQIDQITNISATIAQFLANGQP
IPQLEQALKMPLHSESSVAVQPNQATQSNPVRSNPNQSWGLGMSTGAEGVSAVTASKVSNVDGIQELSLNPKENRDKKTD
EASKEVEGKKIGEDTNDAENVVDEDEDGDGSDEENKKEKDPKGMRAFKFALVEVVKELLKPAWKEGKLNKDGYKNIVKKV
AEKVTGSMQSGNVPQTQEKIDHYLSAAKPKLTKLVQAYISKIKKT*

DNA
ATGGAAATGAGTGGTTTGGGAAGAAAACGTCTTTCAAAGTGGGACTCTAAGGAAGATACACACCATCATCATTCTACCGT
TAATGCAAACTCGGGTTCTTATTACCGCGACAACGAGTCTGAGCCTATCCGGTTCAATGCAGAGAGTAATGGTGAAGCTA
GGACTAGAAGCAGAGTTTCACAGAATAACGATAACAGTTATTTTTCTGAACAAGATGATACTAGGCAACAATTTTTCCCT
AGGAGTGGAAGTAGAAGTAATAGCAGTAGTAGAAGCCGTAGTAGAAGCCCAGTCTATAGAGGTAGACGAGATGCGGGATC
TTATGATAGACACAAGACGAGAACACAAGTTTCTCCTACGCCAATAAGGGAGTTCAATAAAAGAGGCAGTGATCATCAGT
TTGATCAAAGAAGTGATTATGGTTGGGAAGATAACATTAGAAAGCCAAGGGAGACGAAATATCACACCGAAAATATCAGA
GAAGAGGCGATGATGGAAGGTGCGAGGTCTTCTGACTATAATACTGATTATCCCGAGGATAATTCGAGAAGGGAGCATGT
AAATGATGGCGGTTTAGATCCGAGAATGAGAAGGCACAGAAGCGAATTTATGGGAGAGAAGGAAACACAAAGAAGGGGTG
GTGATGGTGAAGGAGGATTCCACAGGAGTTCGAATATTCCGTGCAAGTTTTTCGCTGCCGGGACGGGGTTCTGTCGTAAT
GGCAATTATTGCAGGTTTTCTCATCATGTTGCTGATAGAAAACAGCCTCAAGACAACAACTTTTATAGACAGGACAAAAA
GAATCATAGTAGTGGTCATAATAAATGGAATGATGTTGAAAGATTGGACAACGGAAGAGTAGGTAGAATCGAAGATTCTC
GCGCCAGTAAGGGAGTTTCTGAATCTAAAGGGAATGGTAGTAGCTGGATTGGTGACATGGAGATGTCTCCTGATTGGAAT
TATGGAGTCCAAGCTTTAAAGAAGCCTGTGAAGGAAGAACATGGTGTTGGTATTATTGGTCCGAGTTCACAATCTCGAGT
TCTTAAAGATGATCTGGTGACTAATTATGATCAAAGAAATAGTGGTATGTTTTCACATGGTGACAAAACTATGGCTGAGA
AACCTATAGCTGCTTCACATCAGAGTTACAGTAATTCAGTGAATGTTGCTCCAGTTCAAGCATTCAATCAAAATCATAAT
GTATTGCCGTACCAAAGCTCACTAACTACTGGAGGAAGTCAACAAGTGGTAGCTGCTGCTACAAATTTCTCAGTAGGCTC
GAACTTGAGCAATCTTGAGAGTGGAAAAGTTTATCAAGATAATCATCACTCAATGGTGGAGAAACCTGTTTTGGTCCAAA
ATACAGTAAGTAGGGAACAAATCGATCAGATTACCAACATCTCAGCAACTATAGCGCAGTTTCTTGCAAATGGGCAGCCT
ATTCCACAGCTTGAACAGGCATTAAAGATGCCGCTGCATTCAGAATCTTCCGTGGCTGTTCAACCAAATCAGGCTACTCA
AAGTAATCCAGTGAGAAGTAATCCAAATCAGTCATGGGGACTAGGGATGAGCACTGGTGCTGAAGGAGTCTCAGCGGTTA
CTGCATCAAAGGTAAGCAATGTCGATGGGATTCAGGAACTATCGCTAAATCCCAAGGAAAACAGGGACAAAAAGACTGAT
GAAGCTAGCAAGGAAGTAGAGGGTAAGAAAATTGGAGAAGACACTAATGATGCTGAGAATGTCGTGGATGAAGATGAAGA
TGGTGATGGGAGCGACGAAGAAAACAAGAAAGAGAAAGACCCGAAAGGAATGAGGGCGTTTAAGTTTGCGCTAGTTGAGG
TAGTAAAGGAGCTTCTAAAACCAGCTTGGAAAGAAGGTAAGCTGAACAAAGATGGTTACAAAAACATAGTGAAGAAGGTA
GCTGAGAAAGTGACTGGTAGTATGCAAAGTGGAAACGTTCCTCAAACACAGGAGAAGATTGACCATTATCTATCCGCTGC
AAAACCAAAACTTACCAAGCTCGTGCAGGCATATATCAGCAAAATCAAGAAGACATAA