Details for Lyrate rockcress Locus 16049767

Position : sca3 ( 5`- 653619 .. 650049 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477487 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049767

Protein [Map View]
MSVRVLNPNAEVLNKSAALHMTINAAKGLQDVLKSNLGPKGTIKMLVGGSGDIKLTKDGNTLLKEMQIQNPTAIMIARTA
VAQDDISGDGTTSTVIFIGELMKQSERCIDEGMHPRVLVDGFEIAKRATLQFLDTFKTPVVMGDEPDKEILKMVARTTLR
TKLYEGLADQLTDIVVNSVLCIRKPEEPIDLFMVEIMHMRHKFDVDTRLVEGLVLDHGSRHPDMKRRAENCHILTCNVSL
EYEKSEINAGFFYSNAEQREAMVTAERRSVDERVQKIIELKNKVCAGNDNSFVVLNQKGIDPPSLDLLAREGIIALRRAK
RRNMERLVLACGGEAVNSVDDLTPDSLGWAGLVYEHVLGEEKYTFVEQVKNPHSCTILIKGPNDHTIAQIKDAVRDGLRS
VKNTLEDECVVLGAGAFEVAARQHLINEVKKTVQGRAQLGVEAFANALLVVPKTLAENAGLDTQDVIISLTSEHDKGNVV
GLNLQDGEPVDPQLAGIFDNYSVKRQLINSGPVIASQLLLVDEVIRAGRNMRKPT*

DNA
ATGTCTGTGCGTGTTCTGAATCCTAATGCTGAGGTGCTCAACAAATCGGCCGCGCTTCATATGACCATCAACGCCGCCAA
GGGTTTACAGGATGTACTCAAGTCGAATCTCGGTCCTAAGGGAACTATTAAGATGCTTGTTGGTGGTTCCGGGGATATCA
AGCTTACCAAGGATGGCAACACGCTTTTGAAGGAAATGCAAATTCAAAATCCAACAGCCATCATGATTGCCAGGACAGCT
GTTGCTCAGGATGACATAAGTGGTGATGGTACTACTTCCACTGTCATCTTCATTGGTGAGCTTATGAAGCAGTCGGAGCG
TTGCATCGATGAAGGAATGCATCCACGAGTCTTAGTTGATGGTTTCGAGATTGCGAAAAGAGCTACTCTCCAATTTCTCG
ACACTTTCAAGACACCTGTGGTTATGGGTGATGAGCCTGACAAAGAGATCCTGAAAATGGTTGCCAGGACAACGCTAAGA
ACAAAGCTGTATGAAGGCTTAGCTGATCAACTGACTGATATTGTTGTTAATTCGGTTCTCTGCATTCGGAAGCCTGAGGA
ACCTATTGATCTGTTTATGGTTGAGATTATGCACATGCGCCATAAATTTGATGTTGACACACGATTGGTTGAGGGGCTTG
TTCTTGATCATGGTTCAAGACACCCTGACATGAAGCGACGTGCGGAGAATTGTCACATCTTGACTTGCAATGTGTCATTA
GAGTATGAGAAGAGTGAAATTAATGCAGGATTCTTTTACTCAAATGCGGAACAGAGGGAAGCCATGGTTACTGCTGAGCG
ACGTTCCGTTGATGAAAGAGTTCAGAAAATTATTGAGCTGAAGAACAAGGTTTGTGCTGGTAATGATAACAGCTTTGTTG
TCCTAAATCAAAAGGGTATTGATCCCCCGTCATTGGATCTTCTTGCTAGAGAAGGGATAATCGCTCTTAGAAGAGCAAAG
AGGAGGAACATGGAACGTTTGGTTTTGGCATGTGGTGGAGAAGCTGTGAACTCCGTTGATGACTTGACCCCTGATTCTCT
TGGTTGGGCTGGACTTGTATATGAGCACGTTCTTGGAGAGGAGAAGTACACATTTGTCGAGCAAGTGAAGAATCCTCATT
CATGTACTATCCTCATAAAAGGGCCTAACGACCACACAATTGCTCAAATTAAGGACGCTGTCCGTGATGGTTTAAGATCA
GTTAAGAATACCCTAGAAGATGAGTGTGTCGTATTAGGAGCTGGAGCTTTTGAAGTTGCAGCAAGACAACACTTAATCAA
TGAAGTCAAGAAAACCGTTCAAGGGCGCGCTCAACTCGGTGTTGAAGCTTTTGCTAATGCCCTTCTCGTGGTGCCTAAGA
CACTTGCTGAAAATGCTGGGCTTGACACTCAAGACGTTATCATTTCTCTAACGAGTGAGCATGACAAAGGAAACGTTGTG
GGACTAAACCTACAGGATGGAGAACCAGTCGACCCTCAGCTTGCCGGTATTTTCGACAATTACTCGGTGAAACGCCAACT
TATCAATTCAGGGCCGGTGATTGCTTCGCAGTTGCTATTAGTGGATGAAGTGATTCGTGCAGGAAGAAATATGAGGAAGC
CTACTTAA