Details for Lyrate rockcress Locus 16049766

Position : sca3 ( 5`- 8167461 .. 8165050 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479415 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049766

Protein [Map View]
MPRPFFHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNKIWFQDGWQEFVDRYSIRIGYLL
IFRYEGNSAFSVYIFNLSHSEINYHSTGLMDSAHNHFKRARLFEDLEDEDAEFIFPSSVYPSPLPESTVPANKGYAGSAI
QSLFTGSVKAEEATPTPKIPKKRGRKKKNADPEEINSSAPRDDDPENRSKFYESASARKRTVTAEERERAINAAKTFEPT
NPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKVQLAEKQWPVRCLYKAGRAKFSQGWYEFTLENNLGEGDVCVF
ELLRTRDFVLKVTAFRVNEYV*

DNA
ATGCCACGCCCTTTCTTCCATAAGTTGATTTTCTCATCCACTATCCAAGAAAAACGTCTGAGAGTCCCAGATAAGTTTGT
GAGTAAATTCAAGGATGAGCTTTCGGTTGCTGTTGCACTCACAGTACCTGATGGTCATGTTTGGCGTGTAGGACTAAGGA
AAGCTGACAACAAAATTTGGTTTCAAGATGGTTGGCAAGAGTTTGTTGACCGTTACTCCATTCGCATTGGTTATCTTTTG
ATTTTTAGATACGAAGGAAACTCTGCCTTCAGCGTCTACATTTTCAATTTATCCCACTCTGAGATCAATTACCATTCCAC
CGGTCTCATGGATTCCGCACACAACCACTTCAAACGCGCCCGTTTGTTTGAAGACCTTGAAGATGAAGATGCCGAGTTCA
TCTTTCCTTCTTCCGTGTACCCTTCACCACTTCCTGAGTCTACAGTACCAGCCAACAAAGGGTATGCTGGTTCAGCCATC
CAAAGCTTGTTCACTGGATCTGTTAAAGCTGAAGAGGCAACGCCAACTCCAAAAATTCCGAAAAAGAGAGGGAGGAAGAA
GAAAAATGCTGATCCTGAGGAAATAAACTCATCTGCTCCGCGCGATGATGACCCAGAGAACCGTTCAAAGTTCTACGAGA
GTGCTTCTGCGAGAAAGAGAACCGTGACTGCAGAAGAAAGAGAGAGGGCCATTAATGCAGCCAAAACGTTCGAGCCGACA
AATCCTTTCTTCAGAGTTGTTCTGCGACCATCTTATCTATACAGAGGTTGCATCATGTATCTTCCTTCTGGGTTTGCTGA
GAAGTACCTAAGTGGGATCTCCGGGTTCATCAAGGTCCAGCTCGCGGAGAAACAATGGCCTGTACGATGTCTCTACAAAG
CCGGGAGAGCCAAATTCAGTCAAGGATGGTACGAGTTCACTCTAGAGAACAACCTAGGAGAAGGAGACGTCTGTGTGTTC
GAGCTGCTACGAACCAGAGATTTCGTTCTGAAAGTGACGGCCTTTCGAGTCAACGAGTACGTCTGA