Details for Lyrate rockcress Locus 16049722

Position : sca3 ( 5`- 5330435 .. 5330773 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049722

Protein [Map View]
MEGKEEEAKRRMMMKIKLKETEAEINQDDIKRQEAYNMSPRVRRGGGGGGSVGMSKSSSVRQNCLCAPTTHPGSFRCRYH
RRNAGLGMSRGISVPSNLSMLGGGDSISGSPK*

DNA
ATGGAAGGGAAAGAGGAAGAAGCAAAGAGGAGGATGATGATGAAGATCAAACTTAAGGAGACAGAAGCAGAGATAAACCA
AGATGATATTAAAAGACAAGAAGCTTACAATATGTCTCCACGTGTACGTCGTGGTGGTGGTGGTGGTGGCTCGGTAGGTA
TGAGCAAGTCATCGAGCGTGAGGCAAAACTGTTTATGCGCACCAACGACACACCCTGGCTCCTTCAGGTGCCGTTACCAC
CGTCGCAACGCTGGACTCGGCATGTCTCGTGGCATATCCGTTCCCTCTAACCTTTCCATGTTGGGTGGTGGAGACTCTAT
CTCTGGCTCTCCCAAGTGA