Details for Lyrate rockcress Locus 16049720

Position : sca3 ( 5`- 1862221 .. 1860149 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049720

Protein [Map View]
MEPENSQPFTFRSNPPDQEPAAAQTEDHSRKRVSAYDLMVVDSDLEGVDKKMDKLRNILEQIQKKASSVLEFSPWWEEID
EELDLLKQRAMEVDLKEASLKTQILELEKKEERLKLVEERAMKIEIESDLKRFLEENVARLVLEKQNEEMVVAQLNAHEK
LLQGSMKLKHEELMREVEARREEVALLSKSIDAKTCDLDMKVKAFDLKQTTESERMRMETELIETSLKQLEARENELRLL
NETIKEKSTELEKKEENFQLIQQAQARDVEVKIKFLELREKELGEREKELELKQREVQERSIQAGTRKRTRVESGPSLDA
ESLTQHNQNDEDKEKDSASVLSASTSSREAHEEDIEEVVVSIVRGTHHNDEDHEPLMCVVDSEFNDFSKTMSSIMAGQVW
ALYDNIDSMPRCYGRIKKVNKCQSSLQVTWLEPKDEESVLAACGRFKWGNTETVKSHLAFSHEIHPIIRGKHFIAVNPSK
GETWALFRDWSKSWNNNRKQHKPPYRYDFVEVLVNVDDCLGVGVAYLGKVQGFASVYKQAGQHGVISFMITPEEMQRFSH
KVPSFRLNGEEKEGVPVGSFELDPAAIPSSILKHDRSIRKEAEETEKQSEDCGKTGEVEDKDGSRKDFPIILD*

DNA
ATGGAACCGGAAAATTCCCAACCTTTCACTTTCAGAAGCAACCCGCCGGATCAGGAACCGGCGGCTGCACAAACTGAAGA
TCATTCTCGAAAAAGGGTTTCTGCTTATGATCTTATGGTAGTGGACAGTGATTTAGAGGGAGTTGATAAAAAAATGGACA
AGTTGCGTAATATCTTAGAACAGATTCAGAAGAAAGCTTCATCAGTTCTTGAGTTCTCGCCTTGGTGGGAAGAAATCGAT
GAGGAATTGGATTTGCTAAAGCAACGAGCCATGGAAGTGGATTTGAAGGAGGCATCTCTAAAAACTCAGATTCTGGAGCT
GGAGAAGAAGGAAGAGCGTCTTAAGCTTGTTGAAGAGAGAGCGATGAAGATTGAAATTGAATCTGATTTGAAACGGTTTC
TGGAAGAAAATGTGGCGAGATTGGTTCTTGAGAAGCAGAATGAAGAAATGGTGGTTGCTCAGCTTAACGCACATGAGAAA
TTGCTTCAGGGTTCGATGAAGCTGAAGCATGAAGAGCTTATGAGAGAGGTTGAAGCGAGGAGAGAGGAGGTTGCTTTGCT
TTCCAAGTCGATCGATGCCAAGACTTGTGATTTAGATATGAAAGTGAAGGCCTTTGATCTGAAGCAAACAACAGAGTCTG
AGAGAATGAGAATGGAGACTGAGCTGATTGAAACATCTCTTAAGCAACTTGAAGCGAGGGAGAATGAGCTTAGGTTGCTT
AATGAGACCATCAAAGAGAAATCGACTGAGCTGGAGAAGAAAGAAGAGAACTTTCAACTGATACAACAAGCACAAGCCAG
AGATGTGGAAGTTAAGATTAAGTTTCTTGAGCTAAGGGAGAAGGAACTTGGAGAAAGGGAGAAAGAGCTGGAATTGAAAC
AGAGAGAAGTACAAGAACGATCAATACAAGCTGGGACTCGAAAGAGAACTAGGGTTGAATCTGGGCCGTCATTGGATGCT
GAGTCTCTTACACAACACAACCAAAATGATGAAGACAAGGAAAAAGATTCTGCTTCTGTACTTTCAGCTTCTACATCTTC
TCGTGAAGCACATGAAGAAGATATTGAAGAAGTCGTTGTCTCCATAGTTAGAGGAACACATCACAATGATGAGGACCATG
AGCCATTAATGTGTGTTGTTGATTCAGAGTTCAATGATTTCAGCAAGACAATGAGCTCTATCATGGCTGGTCAAGTATGG
GCTCTATATGATAACATAGATTCAATGCCTAGGTGTTATGGTCGGATCAAGAAAGTTAACAAGTGTCAGTCGAGTCTTCA
AGTGACATGGTTAGAACCTAAAGATGAGGAATCTGTTCTTGCTGCTTGCGGTAGGTTCAAATGGGGGAATACAGAAACCG
TAAAAAGCCATTTGGCCTTTTCCCATGAGATACATCCCATCATACGTGGCAAACACTTCATTGCTGTGAATCCGAGTAAA
GGCGAAACGTGGGCTCTTTTCAGAGACTGGAGCAAAAGCTGGAACAATAACCGGAAACAGCACAAGCCTCCTTATAGGTA
CGACTTTGTGGAAGTTCTAGTCAACGTCGACGATTGTCTAGGTGTTGGAGTGGCCTATTTAGGGAAGGTTCAAGGATTTG
CATCGGTCTATAAACAAGCTGGGCAGCATGGAGTCATCTCATTCATGATCACACCAGAGGAAATGCAAAGATTCTCTCAC
AAAGTGCCGTCATTTAGGTTGAATGGAGAGGAGAAAGAGGGAGTTCCTGTTGGTTCTTTCGAGCTAGACCCTGCTGCTAT
CCCCAGTTCTATACTCAAGCATGATCGATCTATCCGTAAGGAAGCTGAAGAAACAGAAAAACAAAGCGAGGATTGTGGTA
AAACTGGTGAGGTTGAAGATAAAGATGGGTCAAGGAAAGATTTCCCCATTATCTTAGATTGA