Details for Lyrate rockcress Locus 16049703

Position : sca3 ( 5`- 9947864 .. 9948745 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479743 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049703

Protein [Map View]
MITGVLRRSSLPSRQTLSAALTSFDSCLSHHFTSATTGVSVSSRFTLASSPNSFGIGAREFHIRSEPSMIFPAGIAPQGY
ATVTRDRKNEIKKAKLKISPDNVRPLSRKEIALQKEAAEESTSKIKGTKICIAIRSFDNPEKQAWCLPPHTRKVAMPDTR
TLYTVLRSPHVDKKSREQFEMRFKKRFLVIKAQSHELSKKLFWLKRYRILGAQYELQFHCKTRLDMTQVLGNINGSSNTQ
*

DNA
ATGATCACCGGAGTATTGCGCCGATCTTCACTTCCATCGAGGCAGACTCTCTCCGCCGCGTTAACCTCCTTTGATTCATG
TCTTTCGCACCATTTCACTTCAGCCACCACTGGAGTTTCCGTCAGCTCTCGATTCACTCTCGCGTCGTCTCCGAACTCGT
TTGGTATTGGAGCGAGAGAATTCCACATTAGATCTGAGCCGTCGATGATTTTTCCTGCAGGAATCGCGCCACAAGGTTAC
GCCACTGTCACAAGGGATCGCAAAAACGAGATTAAGAAAGCTAAGCTTAAAATTTCTCCTGACAATGTCAGACCATTGAG
TAGGAAGGAGATCGCTCTACAGAAAGAGGCAGCAGAAGAAAGCACATCAAAGATAAAAGGAACTAAGATTTGCATAGCGA
TTCGGTCTTTCGATAACCCGGAAAAGCAAGCTTGGTGTCTTCCTCCTCACACTCGTAAAGTTGCAATGCCCGATACACGA
ACTCTGTACACGGTGCTACGATCGCCTCACGTTGATAAGAAGTCTAGAGAACAGTTTGAGATGCGGTTCAAGAAACGGTT
TCTTGTCATCAAAGCTCAGAGTCATGAGTTGAGCAAGAAGCTGTTTTGGTTAAAACGTTACCGTATTCTTGGAGCTCAAT
ATGAACTCCAATTCCATTGCAAGACTCGTTTGGACATGACTCAAGTGTTAGGCAACATCAATGGCTCCAGCAATACTCAA
TGA