Details for Lyrate rockcress Locus 16049685

Position : sca3 ( 5`- 6217334 .. 6221985 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049685

Protein [Map View]
MADINLPTDFCFRERREREQNPNHLFLEFHHGYMITVVPFVSLRFLFPLLINRSTLFFREQPQYLLYNHSYILRTTMPVV
AEYAKSNRSSCKSCSKKIAVKSLRLGLISKGPGGVDMTRWHHFDCFPTDSESIASVDDIQGLSVLEKEDQDALTKLVEQG
GQEPAKKQRDEKKEKVKKPLVGPKRFNEATTSKVIADYAKSSRSSCKRCSQTIVSKDLRVGLVTRDARGFDVTSWHHLGC
FPIDWHPIDSVEDVGGYSSLEKGDQKELQQLAELSGKDTLIDDVQKMDEGDDESVADNELTEETKKGKHSQVAKLVEQPG
EPAKEVNEDEEIKMPASDEISGQKIKETTGSPDSSKVISEYAKSSRSTCKKCSQTIAAKELRLGLVTRNFRGFDMTQWHH
VGCFPVDSDPISSVEDVGGFSELQSGDQDALKELVQQCGKKTLVDKMDEDNDESEAKNKLTEETNKRKHSEVGEIVEKDE
SLTKANQHKAKTHKVNISESTSQVEVEAEISLSASDVKDKYRDANLLPKWKAFETVIFLERDDGLNDSEKIAAFDFDGCL
AKTSVKIVGADAWSLMYPSIPEKLQSLYNQGYKLVIFTNESNIDRWKNKRQAAVDSKIGRLNSFIERVKVPIQVFIACGV
SSSGGKGSKDDFYRKPKAGMWQLMKKHFNSGIAIDMDKSFYVGDAAGRKMDHSDADIKFAQASGLKFYTPEEYFIPASTS
AGT*

DNA
ATGGCCGACATCAATTTACCGACAGACTTCTGCTTTCGAGAAAGGCGGGAACGAGAACAGAACCCTAATCACCTTTTTCT
CGAATTCCACCATGGCTATATGATTACAGTAGTCCCCTTCGTGTCTCTTCGTTTCCTTTTCCCTCTCCTTATAAATCGTT
CCACTCTCTTCTTCCGAGAACAACCACAGTATCTCCTCTACAACCACAGTTACATTTTGAGAACAACAATGCCGGTCGTT
GCTGAGTACGCGAAGTCGAATCGATCGTCGTGTAAGTCATGCTCGAAAAAGATAGCTGTGAAATCGCTTAGGTTAGGGTT
GATTAGCAAAGGACCTGGCGGGGTTGACATGACCAGGTGGCACCATTTCGATTGTTTTCCGACTGATTCGGAATCGATTG
CTTCCGTTGATGATATTCAAGGCTTATCCGTTTTAGAGAAAGAAGATCAGGATGCTTTGACGAAATTGGTGGAACAAGGT
GGTCAAGAACCTGCTAAAAAACAGCGTGATGAGAAGAAGGAAAAGGTTAAGAAGCCTTTAGTTGGGCCGAAGAGGTTTAA
CGAGGCGACAACTTCAAAAGTTATTGCTGATTATGCGAAATCGAGCAGGTCATCATGCAAGAGGTGCTCTCAGACAATCG
TTTCAAAGGATCTGAGAGTGGGGCTGGTGACTAGAGACGCCAGGGGATTTGATGTGACAAGCTGGCATCACTTGGGTTGT
TTTCCCATTGATTGGCATCCGATTGATTCTGTGGAGGACGTTGGTGGATATTCATCCCTTGAGAAAGGTGACCAGAAAGA
ATTACAGCAATTGGCCGAACTAAGCGGGAAGGACACTTTGATAGATGATGTCCAGAAGATGGATGAAGGTGATGATGAAT
CTGTAGCTGATAATGAGCTAACGGAGGAGACAAAAAAAGGAAAACATTCCCAGGTTGCAAAATTGGTGGAACAACCTGGC
GAGCCTGCAAAAGAAGTCAATGAGGATGAAGAGATAAAAATGCCTGCATCTGATGAAATAAGTGGGCAGAAGATTAAGGA
GACGACAGGTTCTCCTGATTCTTCAAAAGTTATCTCTGAGTATGCGAAATCGAGCAGATCAACTTGCAAGAAGTGCTCTC
AGACTATCGCTGCAAAGGAACTGAGGTTGGGCCTGGTGACCAGAAACTTCCGTGGCTTTGATATGACACAATGGCATCAC
GTGGGTTGTTTTCCTGTTGACTCTGATCCCATTAGTTCTGTAGAGGACGTTGGTGGATTTTCAGAACTGCAGAGTGGTGA
TCAGGATGCTTTAAAGGAATTGGTCCAACAATGCGGGAAGAAGACTTTGGTAGATAAGATGGATGAAGATAATGATGAAT
CTGAAGCTAAGAATAAGCTAACTGAGGAGACAAACAAAAGAAAACATTCTGAGGTTGGGGAGATAGTGGAAAAAGATGAA
TCGCTAACTAAAGCAAACCAACATAAGGCTAAAACACATAAGGTGAATATCAGTGAGTCGACTTCTCAGGTCGAGGTCGA
AGCAGAAATCTCTCTTTCAGCTTCTGATGTGAAGGATAAGTACAGGGATGCCAATCTATTACCAAAATGGAAAGCTTTTG
AGACAGTTATATTCCTTGAGCGGGATGATGGTCTTAATGATTCAGAGAAAATAGCTGCATTTGATTTTGATGGATGCCTT
GCAAAAACATCTGTGAAAATAGTAGGGGCAGATGCATGGTCCCTAATGTATCCTTCCATTCCTGAGAAACTGCAAAGTCT
GTACAATCAAGGCTATAAGCTGGTCATTTTCACAAATGAATCCAACATTGATCGATGGAAGAACAAGCGGCAAGCTGCTG
TAGATTCGAAAATCGGACGTCTCAACAGTTTTATCGAGCGCGTGAAGGTCCCCATTCAGGTGTTTATAGCCTGTGGAGTC
TCAAGTTCTGGTGGTAAAGGTAGTAAAGATGACTTTTACCGCAAACCCAAGGCTGGAATGTGGCAACTCATGAAGAAGCA
CTTTAACTCTGGAATTGCAATTGATATGGATAAATCCTTCTACGTTGGGGATGCAGCCGGAAGAAAAATGGATCACAGCG
ACGCTGACATCAAATTTGCACAGGCGAGTGGGCTAAAGTTTTATACCCCGGAGGAATACTTTATCCCCGCAAGTACATCG
GCAGGGACTTAG