Details for Lyrate rockcress Locus 16049589

Position : sca3 ( 5`- 4801096 .. 4805720 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049589

Protein [Map View]
MIPIKFARENPRNSEKVTNGQSCTISSDIVSPPCSNSNPMSDHGHPATPIREAVSQNPMKEISIDDSYLPPHPQLPKLEP
PRGRRVSLEELLHPPEKFTADLMKFVRQSGNAISKRISVLLENDDDSDSKKTIDDDVTEFKISGVKVLVKMKTEEEIRGR
ITFFSRSNCRDSTAVRLFLREQGFDFSEINIDVYTAREKELIERTGSSQVPQIFFNEKHFGGLMALNSLRNSGEFDLRVK
EFLKEKCCGDAPAPVMYGFDEESNKDVVVVDEILRFVRVLRQKLPIKDRLLKMKIVKNCFSGAEMIEILIDYLDCGRNKA
VEVGMRLAKKHFIHHVFGENEFEDGNHYYRFLEHEPFISKCYNFRGSTNDMEPQNAGIVGQKLFKIMTAILESYSSNDRS
CVDYLRISQSEEFRRYLNLAQDLHRLNIVELSTEEKLAFFLNLYNAMVIHALIRIGRPEGVIARRSFFTDFQYVVGGYSY
SLSSIRNDILRRGRRPSYPFIIPFINDNARHKLGLQKLNPLVHFGLCDGTKSSPVVRFFTPQGVEAELKRAAREFFQNGG
IEVVLDKRTIHLSKIIKWYKEDFSEEKKMLKWIMSYIDANDAGLLTHLLGDGGGSFNIVYQDYDWSINN*

DNA
ATGATTCCAATTAAATTTGCTCGTGAAAATCCGAGAAATTCTGAGAAAGTAACAAACGGCCAAAGTTGCACTATCTCTTC
GGATATTGTTTCTCCTCCATGTTCAAATTCAAATCCCATGAGCGATCACGGACATCCCGCCACACCCATTCGTGAAGCCG
TCTCTCAAAATCCGATGAAGGAAATCTCAATCGATGATTCATATCTTCCACCACATCCTCAGCTACCGAAACTTGAGCCG
CCACGTGGCCGTCGTGTCTCTTTAGAAGAATTGTTGCATCCACCGGAGAAATTCACCGCCGATCTGATGAAATTCGTACG
TCAAAGCGGGAACGCGATTTCGAAACGCATCTCGGTTTTGCTAGAGAACGACGACGACTCCGACTCGAAGAAGACGATCG
ATGATGACGTGACCGAGTTCAAAATCTCTGGAGTCAAAGTTCTCGTGAAGATGAAAACCGAAGAAGAAATCAGAGGTCGT
ATAACTTTCTTCTCCAGATCTAATTGCCGAGATTCAACCGCCGTCAGATTGTTTCTCCGGGAACAAGGCTTCGATTTCTC
GGAGATCAACATCGATGTGTATACGGCAAGAGAGAAAGAGCTGATCGAAAGAACAGGGAGTTCTCAAGTTCCTCAGATAT
TCTTCAACGAGAAACACTTCGGAGGATTAATGGCGCTGAATTCTCTGAGAAACAGTGGTGAATTTGATCTGAGGGTTAAG
GAGTTTTTGAAGGAGAAGTGTTGCGGCGATGCACCGGCGCCGGTGATGTATGGATTCGACGAAGAGAGTAATAAGGATGT
TGTTGTTGTTGATGAGATTTTGAGATTCGTTAGGGTTTTGAGACAGAAGCTACCGATTAAGGATCGTTTGTTGAAGATGA
AGATCGTTAAGAACTGTTTCTCCGGCGCCGAGATGATCGAGATTCTCATTGATTACTTGGATTGCGGGAGGAACAAGGCT
GTTGAAGTTGGCATGAGGCTAGCCAAAAAACACTTTATCCACCATGTCTTTGGAGAGAACGAGTTTGAAGATGGAAATCA
TTACTACCGTTTCCTAGAGCACGAACCGTTTATTTCAAAATGTTACAATTTTAGAGGTTCTACCAACGACATGGAGCCCC
AAAATGCAGGCATCGTTGGGCAGAAGCTTTTCAAAATCATGACTGCTATTCTTGAGTCTTATTCTTCCAATGACCGTTCT
TGTGTTGATTACCTGAGAATCAGCCAGAGCGAAGAATTCCGAAGGTACTTGAATTTGGCTCAAGACCTTCACCGTTTGAA
TATTGTGGAACTCTCAACGGAAGAGAAGTTAGCATTTTTCTTGAACTTGTACAACGCAATGGTGATTCATGCTTTGATCA
GAATCGGACGTCCTGAGGGAGTGATCGCAAGAAGGTCATTTTTTACAGATTTTCAGTACGTCGTAGGAGGCTACTCTTAT
TCACTTAGCTCCATCCGAAATGACATCCTTCGACGCGGTCGCAGACCCTCTTATCCCTTTATTATTCCGTTTATTAACGA
CAATGCACGACATAAGCTTGGACTTCAAAAACTGAATCCATTAGTACATTTTGGCTTATGCGATGGGACCAAATCAAGTC
CAGTGGTGAGGTTTTTCACACCGCAAGGAGTTGAAGCTGAACTCAAACGAGCAGCTAGAGAGTTTTTTCAAAATGGTGGA
ATTGAGGTTGTCTTGGACAAGAGGACCATACATCTATCAAAAATCATCAAGTGGTACAAAGAGGATTTCAGTGAAGAGAA
GAAAATGTTGAAGTGGATAATGAGTTATATAGATGCAAACGATGCAGGTCTTTTAACCCATCTTCTTGGTGATGGAGGAG
GTTCTTTTAACATCGTTTACCAAGATTATGATTGGTCTATCAACAATTGA