Details for Lyrate rockcress Locus 16049586

Position : sca3 ( 5`- 22153153 .. 22154043 -3` )
Annotation : [B2G] undecaprenyl pyrophosphate synthetase family protein
External links : CoGe
PGDD synteny : 16049586

Protein [Map View]
MAELPGQIRRMSGGISQLIEQIYGFSRRCLFRVISMGPIPSHLAFIMDGNRRYAKKHSLEDGSGHQAGFSALMSMLQYCY
ELGIKYVTIYAFSIDNFRRKPEEVQSLMDLMLEKIKSLLEKESIVHQYGIRVYFIGNLALLNDQVRAAAEKVMKATAKNS
RVVLLICIAYNSTDEIVQAVKKSCINTSDNIEASGNYKHEDRDSDIEGTDMENQEKRIQLVDIEENMRMSVAPDPDILVR
SSGETRLSNFLLWQTGNTQLFSPAALWPEIGLKHLLWAVLNFQRNHSYLEKRKKQL*

DNA
ATGGCTGAACTTCCAGGTCAAATAAGACGTATGAGCGGTGGAATTAGTCAATTGATAGAGCAGATATATGGGTTTTCGAG
AAGATGTTTGTTTCGGGTCATATCTATGGGTCCTATACCTAGTCATCTCGCCTTTATCATGGATGGAAATAGGAGATATG
CAAAAAAGCACAGTCTAGAAGATGGGTCTGGTCATCAAGCAGGGTTTTCTGCGCTTATGTCGATGCTGCAGTACTGCTAT
GAGCTGGGTATCAAGTATGTAACGATATACGCATTTAGCATAGATAATTTTAGAAGAAAACCTGAGGAGGTTCAGTCTCT
AATGGATTTAATGCTGGAAAAGATAAAGTCTTTGCTTGAGAAAGAGAGTATTGTGCATCAGTATGGGATTCGGGTCTATT
TTATCGGTAATTTGGCGCTGCTAAATGACCAAGTGAGAGCTGCTGCAGAAAAAGTCATGAAGGCCACAGCTAAGAATAGT
CGGGTAGTGCTTCTCATCTGCATTGCCTATAACTCGACAGATGAGATCGTACAAGCTGTCAAGAAATCTTGTATTAACAC
GTCAGACAATATTGAAGCATCTGGTAATTATAAACACGAGGATAGAGATAGTGATATAGAAGGAACAGATATGGAGAACC
AGGAGAAGAGGATACAGTTGGTGGATATTGAGGAGAATATGCGGATGAGCGTGGCTCCGGATCCTGATATACTCGTCAGG
AGTTCAGGAGAGACAAGGCTGAGCAATTTTCTTTTATGGCAAACAGGTAATACCCAGCTCTTCTCTCCGGCTGCTCTGTG
GCCTGAGATTGGTCTGAAGCATCTGCTCTGGGCTGTATTGAACTTCCAAAGAAATCATTCATACTTGGAGAAGAGGAAGA
AACAATTGTGA