Details for Lyrate rockcress Locus 16049481

Position : sca3 ( 5`- 22269538 .. 22275196 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049481

Protein [Map View]
MIADGAEDEEKWLAAGAAAFKQNAFYMQRAIDSNNLKDALKYSAQMLSELRTSKLSPPKYYDLYMRAFDELRKLEIFFME
ETRRGCSVIELYELVQHAGNILPRLYLLCTAGSVYIKTKEAPSKEILKDLVEMCRGIQHPLRGLFLRSYLAQISRDKLPD
IGSEYEGDADTVTDAVEFVLLNFTEMNKLWVRMQHQGPAREKERREKERGELRDLVGKNLHVLSQLEGVDLDMYRDTVLP
RVLEQIVNCRDEIAQYYLIDCIIQVFPDEYHLQTLDVLLGACPQLQPSVDIMTVLSRLMERLSNYAALNAEVLPYFLQVE
AFSKLNNAIGKVIEAQEDMPILSAVTLYSSLLKFTLHVHPDRLDYADQVLGSCVKQLSGKGKIDDTRATKELVSLLSAPL
EKYNDVVTALKLTNYPLVVEYLDTETKRIMATVIIRSIMKNNTLITTAEKVEALFELIKGLINDLDEPQGLEVDEDDFEE
EQNSVARLIHMLYNDDPEEMFKIVSILKKHFLTGGPKRLKFTIPPLVVSTLKLIRRLPVEGDNPFGKEASVTATKIFQFL
NQIIEALPNVPSPDLAFRLYLQCAEAANKCDEEPIAYEFFTQAYILYEEEISDSKAQVTALQLIIGTLQRMHVFGVENRD
TLTHKATGYSAKLLKKPDQCRAVYACSHLFWLEDRETIQDGERVLLCLKRALKIANSAQQMANKARGSTGSVTLFIEILN
KYLYFYQKGVPQITVESVESLIKLIKNEESMASDPSAESFFASTLQFMEFEKQKEGAIGERYQEIKV*

DNA
ATGATCGCAGACGGAGCAGAAGATGAAGAGAAATGGCTCGCCGCCGGTGCTGCTGCTTTCAAGCAAAACGCATTCTACAT
GCAACGCGCTATTGACTCGAATAATCTGAAAGATGCTCTCAAGTATTCGGCTCAGATGCTTAGCGAGTTACGGACTTCGA
AGCTATCACCTCCCAAGTACTATGATCTCTATATGCGAGCTTTTGATGAATTGAGGAAACTTGAGATTTTCTTTATGGAA
GAAACTCGGCGTGGCTGCTCGGTCATTGAACTCTATGAGCTGGTTCAGCATGCTGGTAACATATTACCACGTTTGTATCT
CCTATGTACAGCAGGATCCGTTTATATCAAAACCAAGGAAGCTCCTTCCAAGGAAATTCTTAAAGATCTTGTTGAGATGT
GTCGTGGGATTCAGCATCCTCTACGTGGTCTCTTCTTGAGAAGTTACCTTGCGCAGATTAGTCGAGATAAATTACCTGAC
ATTGGTTCTGAGTATGAAGGAGATGCTGATACAGTCACAGATGCTGTGGAGTTTGTACTACTGAACTTTACTGAGATGAA
TAAACTCTGGGTCAGAATGCAACATCAGGGACCTGCTCGAGAAAAGGAGAGACGGGAGAAAGAGAGGGGCGAGCTTCGTG
ACCTTGTTGGAAAGAACCTTCACGTGCTGAGTCAGTTAGAAGGTGTGGACCTTGATATGTACAGAGATACAGTTCTTCCT
AGAGTCTTAGAGCAGATAGTGAACTGCAGAGATGAGATTGCCCAATATTACCTAATAGACTGTATCATTCAAGTTTTTCC
TGACGAGTATCACTTGCAGACTCTAGATGTACTTCTTGGGGCGTGTCCACAACTTCAGCCATCAGTTGACATCATGACAG
TGCTTTCCCGTTTAATGGAGAGGCTGTCAAATTATGCTGCCTTAAATGCTGAAGTATTACCTTACTTCCTGCAAGTGGAA
GCTTTCTCAAAGTTGAATAATGCAATTGGAAAGGTGATAGAAGCGCAAGAAGACATGCCTATTCTGAGTGCAGTAACCCT
ATATTCCTCCCTTCTCAAGTTTACTCTTCATGTTCACCCTGATCGGCTTGATTATGCGGACCAAGTGTTGGGATCATGTG
TTAAGCAACTGTCCGGAAAAGGAAAGATTGATGACACTCGTGCAACAAAGGAGCTTGTTTCGCTTTTAAGTGCTCCCTTA
GAGAAGTATAATGATGTTGTCACCGCCCTTAAATTAACTAACTATCCCCTTGTAGTGGAGTACCTTGATACCGAAACAAA
GAGAATAATGGCTACTGTTATAATTCGAAGCATTATGAAAAACAATACTCTTATTACTACAGCGGAGAAGGTTGAAGCAT
TGTTTGAACTGATTAAAGGACTTATCAACGATTTGGATGAGCCGCAAGGTCTTGAGGTTGATGAAGATGATTTTGAGGAG
GAGCAGAATTCTGTTGCGCGTCTCATTCACATGTTATATAATGATGACCCAGAAGAGATGTTTAAGATAGTCAGTATCCT
GAAGAAGCATTTCCTGACAGGAGGGCCAAAGCGCTTAAAGTTCACCATTCCTCCCCTTGTTGTTTCTACTCTAAAGCTAA
TCAGGCGATTGCCAGTGGAAGGAGACAATCCTTTTGGAAAAGAGGCTTCCGTTACTGCTACTAAAATATTCCAATTTCTA
AATCAGATTATCGAAGCGCTACCTAATGTTCCATCACCTGACCTGGCATTCCGGTTGTACTTGCAATGTGCTGAGGCTGC
GAATAAGTGTGATGAAGAACCAATTGCATACGAATTTTTCACCCAGGCATACATCTTATACGAAGAAGAAATTTCGGACT
CAAAGGCCCAAGTGACCGCGTTACAACTTATAATTGGAACTCTGCAAAGGATGCACGTATTTGGTGTTGAGAATAGAGAT
ACATTAACGCACAAGGCTACAGGGTATTCAGCGAAACTTCTAAAGAAACCTGATCAATGTCGAGCTGTTTATGCCTGTTC
ACATTTGTTCTGGCTGGAAGATCGTGAGACCATACAAGATGGAGAAAGGGTTCTACTTTGTCTGAAACGAGCGCTTAAAA
TTGCAAATTCGGCTCAACAAATGGCCAACAAAGCACGGGGTAGTACAGGATCTGTTACCCTCTTCATCGAGATACTAAAC
AAGTACCTTTATTTCTATCAGAAAGGGGTTCCACAGATAACAGTTGAATCAGTGGAAAGCCTGATAAAACTAATCAAGAA
CGAAGAATCGATGGCATCTGATCCATCTGCTGAATCGTTCTTTGCAAGTACGCTTCAGTTCATGGAGTTCGAAAAGCAGA
AAGAGGGTGCCATTGGTGAGAGATACCAGGAGATCAAAGTATAG