Details for Lyrate rockcress Locus 16049395

Position : sca3 ( 5`- 5347388 .. 5348035 -3` )
Annotation : [B2G] nucleic acid binding protein
External links : CoGe
PGDD synteny : 16049395

Protein [Map View]
MAESTQMEVETATGGTVSLPPKPTFKPLKAHEMSDGKVQFRKISVPPNRYSPLKKAWLDIYTPIYDQMKVDIRMNLKARK
VELKTRADTPDISNLQKSADFVHAFMLGFDIPDAISLLRMDELYVESFEIKDVKTLKGEHLSRAIGRLSGKGGKTKFAIE
NSTKTRIVIADTRIHILGAFSNIKVARGSLCSLIMGSPAGKVYSKLRSVSARLNE*

DNA
ATGGCAGAGTCTACTCAGATGGAAGTTGAGACTGCAACAGGAGGAACTGTGTCATTGCCTCCTAAACCAACCTTCAAGCC
TTTGAAAGCGCATGAAATGTCTGATGGTAAAGTTCAATTCAGGAAAATATCTGTACCACCAAACCGATACTCGCCTCTCA
AGAAAGCATGGTTGGATATCTACACACCCATTTACGATCAGATGAAGGTTGACATTAGGATGAATCTCAAAGCCCGCAAA
GTCGAGCTTAAAACCCGAGCTGACACTCCCGACATCAGTAATCTCCAGAAGTCTGCGGATTTTGTACATGCTTTCATGCT
GGGTTTTGATATCCCTGATGCTATCTCTCTTTTGAGAATGGACGAGCTTTATGTTGAGTCTTTCGAGATCAAAGATGTGA
AGACTCTTAAAGGTGAGCATTTGTCTCGAGCCATTGGGAGATTGTCTGGTAAAGGAGGGAAGACAAAGTTTGCTATTGAG
AACTCGACCAAGACGAGGATTGTGATTGCAGACACTAGGATTCATATTTTGGGAGCTTTCTCTAATATTAAAGTCGCAAG
GGGTTCACTTTGCAGTCTTATTATGGGATCTCCTGCTGGGAAAGTTTACTCTAAGCTCAGATCTGTCTCTGCTAGATTGA
ACGAATAG