Details for Lyrate rockcress Locus 16049362

Position : sca3 ( 5`- 3419019 .. 3420035 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049362

Protein [Map View]
MAAMAAKLHLSAKSDQSNVRLPRVINLSRYPTTRVSFPRNDSVSSLHTNFSSTHLGVPCAGGGDGGGSIGNHGGGSGSGG
GGYGGSEEEGSSSWGPIGIFIQGWRSRVAADPQFPFKVLMEELVGVSANVLGDMASRPNFGLNELDFVFSTLVVGSILNF
TLMYLLAPSAVSHGSSNLLPGIFRSCPSSHMFEQGSFTIMNRFGTLVYKGMVFATVGLAAGLVGTAISNGLIMLRKKMDP
SFETPNKPPPTLLNSLTWATHMGVSANVRYQTLNGAEFLLEKSLPPLVFKTSVIVLRVVNNVLGGMSFVILARMTGSQSV
EEEKKIEMSEISEKEKED*

DNA
ATGGCGGCTATGGCGGCGAAGCTTCATTTATCGGCGAAATCAGATCAGAGCAATGTGCGATTGCCGAGAGTGATCAACCT
CTCCCGCTATCCAACCACTAGAGTCTCGTTTCCACGAAATGATTCTGTTTCTTCACTCCACACTAACTTCTCTTCTACAC
ATCTCGGGGTTCCATGCGCCGGAGGTGGTGATGGTGGTGGAAGCATCGGTAATCACGGCGGTGGAAGTGGAAGCGGAGGA
GGTGGTTATGGAGGTTCAGAAGAAGAAGGATCGTCTTCATGGGGACCAATAGGAATATTCATACAAGGATGGCGATCACG
AGTTGCAGCAGATCCTCAGTTCCCTTTCAAGGTACTAATGGAAGAGCTTGTTGGCGTTAGCGCCAATGTACTTGGCGACA
TGGCTTCACGCCCTAATTTCGGATTGAACGAGCTAGATTTCGTCTTCTCCACTCTTGTTGTAGGTTCGATTCTCAATTTC
ACACTCATGTACCTCTTAGCTCCCTCTGCAGTATCTCATGGATCCTCCAATTTATTGCCTGGAATCTTTAGAAGCTGTCC
GTCGAGCCATATGTTTGAACAGGGTAGCTTCACTATTATGAACCGTTTTGGGACTCTTGTGTACAAAGGAATGGTTTTTG
CGACCGTGGGGTTGGCTGCAGGTCTTGTTGGAACCGCTATCTCGAACGGGTTGATCATGCTGAGAAAGAAGATGGATCCG
AGCTTCGAAACGCCGAACAAACCACCACCTACGCTGCTGAATTCTTTAACTTGGGCTACACATATGGGAGTGAGCGCCAA
TGTGAGGTACCAAACGTTGAATGGGGCTGAGTTCTTGCTGGAAAAGTCGTTGCCGCCATTGGTGTTTAAGACAAGTGTGA
TAGTTTTGAGGGTTGTGAACAATGTTTTGGGAGGAATGTCGTTTGTTATATTGGCGAGGATGACTGGATCACAGTCGGTG
GAGGAGGAGAAGAAGATAGAGATGTCAGAGATATCAGAGAAGGAGAAAGAGGATTGA