Details for Lyrate rockcress Locus 16049357

Position : sca3 ( 5`- 5725437 .. 5726199 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049357

Protein [Map View]
MVMIHIVSWVGATSRPIASSHVSFHPEITSPQAAEHNSKRPMLVPNENKEIKEEMEKRRRIGSKPPSCDKKCYGCEPCEA
IQVPTISSIPHLSPHYANYQPEGWRCHCAP*

DNA
ATGGTGATGATACATATAGTGAGCTGGGTTGGTGCAACAAGCAGGCCTATTGCTTCCAGTCACGTTTCTTTTCATCCAGA
GATAACAAGCCCACAGGCTGCAGAACACAACTCTAAAAGGCCCATGTTGGTTCCCAATGAGAATAAAGAGATAAAAGAAG
AAATGGAGAAAAGAAGAAGAATAGGATCAAAGCCACCAAGTTGTGATAAGAAATGCTATGGATGTGAGCCATGTGAAGCA
ATTCAAGTCCCTACCATTTCTTCAATTCCTCATCTATCTCCTCATTATGCTAATTATCAGCCAGAGGGTTGGAGATGCCA
TTGTGCTCCTTAA