Details for Lyrate rockcress Locus 16049343

Position : sca3 ( 5`- 5179511 .. 5178333 -3` )
Annotation : [B2G] protein binding protein
External links : CoGe
PGDD synteny : 16049343

Protein [Map View]
MAVEAHHLNPLFSSNREMIHPVEANGLAYNTQMRYGTVPTFNPTVECQTSLFSPIYNISPVDGLVHQSMKPTIHSVDSSV
TFNSENDFLRPVSSRKRSREESVVLNPSAYMQSHKNPTDPLMFLGQDLSSNVQQHHFDIDRLISNHVERMRMEIEEKRKT
QGRRIVEAVEQGLMKTLRAKDEEINHIGKLNLFLEEKVKSLCVENQIWRDVAQSNEATVNALRSNLQQVLATVERNRWEE
PPTVADDAESCCGSNDEGDSEEERWKLAGEAQDTKKMRRVGLSMCRSCGKGEASVLLLPCRHMCLCTVCGSSLNTCPICK
SPKNASLHVNLSS*

DNA
ATGGCCGTTGAAGCTCACCATCTTAATCCTCTGTTTTCTTCCAACAGAGAAATGATTCATCCCGTTGAAGCAAACGGCTT
AGCCTATAACACCCAGATGAGATACGGCACCGTTCCGACGTTTAACCCTACCGTAGAATGTCAAACTTCTCTGTTTAGTC
CCATCTACAACATCTCACCAGTTGATGGTTTGGTTCATCAATCCATGAAACCAACGATACATTCCGTTGATAGTTCTGTC
ACATTCAACAGCGAGAACGATTTTCTTCGTCCTGTGTCGTCGAGAAAACGTTCCAGAGAAGAATCCGTTGTTTTAAATCC
TTCCGCTTATATGCAAAGCCATAAAAATCCCACCGATCCTCTCATGTTTCTTGGCCAAGACTTGTCTTCTAACGTCCAAC
AACATCATTTCGATATCGATCGTTTGATCTCTAATCACGTTGAGAGAATGAGAATGGAAATTGAAGAGAAGAGAAAAACT
CAAGGGAGGAGGATAGTGGAAGCCGTGGAACAAGGTTTGATGAAGACACTAAGAGCCAAAGACGAAGAGATCAATCACAT
CGGGAAACTAAACCTCTTTCTAGAAGAGAAGGTTAAGTCTTTGTGCGTAGAGAATCAGATATGGCGTGACGTGGCACAGT
CTAATGAAGCCACCGTAAACGCCCTCCGTTCCAACTTACAACAAGTTCTCGCCACCGTTGAGCGTAACCGGTGGGAGGAG
CCGCCCACGGTGGCTGACGACGCGGAGTCTTGTTGCGGTAGCAACGACGAAGGCGATAGCGAGGAAGAGCGGTGGAAGTT
AGCGGGAGAAGCGCAGGATACGAAAAAGATGCGTAGGGTAGGGTTGAGTATGTGTAGAAGCTGTGGGAAAGGAGAAGCAA
GTGTGTTACTGTTACCGTGCAGACACATGTGTCTTTGTACTGTGTGTGGTTCTTCACTCAACACTTGTCCCATATGTAAA
TCTCCAAAGAACGCTAGTCTACATGTTAATCTTTCCTCTTAG