Details for Lyrate rockcress Locus 16049325

Position : sca3 ( 5`- 22219140 .. 22219633 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049325

Protein [Map View]
MKSIFFKLLLLVSLLVITFRQNYAVADYCDRDDDCKPVCMRPYACNLTRHVCMCRPNDVSSSKQRCIPEHKGCGRGPPPH
*

DNA
ATGAAGAGCATATTTTTTAAGCTTTTGTTATTGGTTTCTCTTCTAGTCATTACCTTCCGACAAAACTATGCAGTCGCGGA
TTATTGTGATAGAGACGATGACTGCAAGCCAGTATGCATGAGACCGTACGCTTGCAACTTGACCCGTCACGTTTGTATGT
GTCGTCCAAATGATGTCAGTTCTTCTAAACAACGTTGTATTCCAGAACATAAAGGTTGTGGAAGAGGACCTCCACCGCAT
TGA