Details for Lyrate rockcress Locus 16049284

Position : sca3 ( 5`- 7810464 .. 7812192 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049284

Protein [Map View]
MRGALFRNASLCARRFILSPRITHQISPNVPFLAPIASPAPLKFSFFSSESDSSGENSTTAPDSSPSESSDKKDLVVEDV
SNKELKSRIEKYFNEGNEDALPGVIEALLQRRLADKHAETDDELIEKIETLPFKDDVKDEDFESDFEDAHSTDEELEDLY
NSPEYVAEKMRKNEFFNMDDKKWDHMIREGIQHGCLTDTKECEEILEDMLKWDQLLPDDLKKKVEAKFNELGDMCERGEL
EAEAAYELFKEFEDEMVIQYGDQMEAEGPPQFGETDASDRKTDLDDPPGKGPILRWQSRIVFAPGGDAWHPKNRKVKMSV
TVKELGLSKHQAKRLRELVGKRYHSGKDELTITSERFEHREENRKDCLRTLYGLIEEAGKANKIAEDIRTSYVKQRLRAN
PAFMQKLQAKIIRSKESDAINA*

DNA
ATGAGAGGAGCTCTCTTCAGGAATGCATCTCTCTGCGCTCGCAGATTCATTCTTTCTCCTCGTATAACCCATCAGATCTC
CCCCAATGTTCCCTTTCTCGCTCCAATCGCCTCTCCAGCTCCTCTCAAATTCAGTTTTTTCTCCTCCGAATCCGACTCGT
CCGGTGAAAACTCGACTACTGCCCCTGATTCTTCGCCGAGTGAATCCTCCGATAAGAAGGATCTCGTTGTAGAAGATGTA
AGCAACAAAGAGCTTAAAAGCCGTATAGAGAAGTATTTCAATGAGGGTAATGAAGATGCTTTGCCCGGAGTTATTGAAGC
ACTTCTACAGAGAAGACTTGCTGACAAACACGCAGAGACTGATGATGAATTGATTGAAAAAATCGAGACTTTACCTTTCA
AAGATGATGTCAAGGATGAAGATTTTGAATCTGATTTCGAGGATGCGCATTCTACTGACGAAGAGCTTGAGGATTTGTAC
AACTCTCCCGAGTATGTAGCTGAAAAGATGAGGAAGAATGAATTTTTCAACATGGACGATAAGAAGTGGGATCACATGAT
TAGAGAAGGCATCCAACATGGGTGTCTTACCGATACTAAGGAATGCGAGGAGATTCTTGAGGATATGCTCAAATGGGACC
AGCTTCTTCCTGATGACTTGAAGAAAAAAGTTGAGGCAAAGTTTAATGAGCTTGGGGATATGTGTGAAAGAGGTGAACTT
GAGGCTGAAGCAGCTTATGAGCTTTTCAAGGAATTTGAAGATGAAATGGTAATTCAGTATGGGGATCAAATGGAAGCTGA
GGGTCCTCCCCAATTTGGTGAAACAGATGCTTCCGATAGGAAAACTGACTTGGATGATCCCCCCGGTAAAGGCCCAATCC
TCAGGTGGCAGTCAAGGATAGTTTTTGCTCCTGGAGGTGATGCGTGGCATCCAAAGAACAGGAAAGTGAAAATGTCTGTT
ACAGTGAAAGAGCTCGGGCTCTCAAAGCATCAGGCTAAAAGGCTAAGGGAACTTGTGGGGAAAAGATACCATTCGGGGAA
AGACGAGCTTACAATCACCAGCGAAAGGTTTGAACACCGAGAGGAAAACAGGAAAGACTGCTTAAGAACTCTTTACGGGT
TGATAGAGGAAGCTGGGAAAGCCAACAAGATCGCTGAGGACATAAGAACTTCATATGTAAAACAGAGACTCCGAGCCAAT
CCAGCTTTTATGCAGAAACTACAAGCCAAGATCATAAGGTCTAAAGAATCAGATGCCATCAACGCCTGA