Details for Lyrate rockcress Locus 16049236

Position : sca3 ( 5`- 10355141 .. 10356960 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049236

Protein [Map View]
EQNNRRIVLALQSGLKSEVTWALNTLTLLSFKEKDDIRRDVTPLAKISGLLDALLLIIDDWRDIALPKDLTRGTRVRTLG
TNASVTGFGNEYDALASIQLPGSGIGSSAAEGLGKKSGGKHQSSQWWMEEDGLFNLDDEGRSEKQMCAIAASNVIRNFSF
MPDNEVVMAQHRHCLETVFQCIHDHMTEDEELVTNSLETIVNLAHLMDLRIFSSLKQSYININEKKAVQAVVGILDSSVK
AWNCAAAELLGRLIINPDNEPFISPLIPQIHKRLVDLLSIQAVDAQAAAVGALYNLVEVNMDCRLKLASERWAVDRLLKV
IKTPHPVPEVCRKAAMILENLVSEPQNRGLLLAYENAFAELLFQDGKYSDSFARILYELTARSNSRVASARGIWG

DNA
GAGCAGAACAATAGAAGAATAGTTCTTGCGCTACAAAGTGGTTTAAAGAGTGAAGTAACATGGGCGTTGAATACACTTAC
ATTGCTTTCCTTTAAGGAAAAAGACGATATTCGAAGAGATGTCACGCCTCTTGCTAAGATATCTGGCTTGCTTGATGCAC
TTCTCTTAATTATAGATGACTGGCGTGACATAGCTCTTCCAAAGGATCTAACAAGAGGAACTAGGGTTAGGACTTTAGGT
ACAAATGCTTCGGTTACGGGATTTGGCAATGAGTATGATGCTCTAGCCTCTATTCAACTCCCTGGATCCGGCATTGGTTC
TTCAGCTGCTGAGGGATTAGGGAAAAAGAGCGGTGGAAAACATCAGTCATCTCAGTGGTGGATGGAAGAGGATGGTTTGT
TTAATCTAGACGATGAAGGGAGATCAGAGAAACAAATGTGCGCCATTGCTGCATCTAACGTTATCCGCAACTTCTCCTTT
ATGCCTGATAATGAAGTTGTAATGGCTCAGCATCGCCATTGCTTAGAAACTGTCTTCCAGTGCATACACGATCATATGAC
TGAGGATGAAGAGCTGGTCACAAACTCGCTCGAGACAATCGTAAACCTGGCGCATTTGATGGATCTTCGAATTTTCAGCT
CGCTTAAGCAGTCATACATTAACATAAATGAGAAGAAAGCTGTTCAAGCTGTGGTTGGAATCCTCGATTCTTCCGTCAAA
GCTTGGAATTGTGCTGCTGCTGAATTACTGGGGCGTTTGATTATTAATCCGGACAATGAACCTTTCATTAGTCCCTTAAT
CCCGCAGATACACAAGCGACTAGTCGATCTCTTGAGCATACAAGCCGTTGATGCACAAGCCGCAGCTGTTGGAGCACTCT
ACAATCTCGTGGAAGTTAACATGGATTGCAGATTAAAGCTCGCAAGTGAGAGATGGGCGGTTGATAGATTGCTAAAAGTG
ATAAAGACTCCGCATCCAGTTCCAGAAGTATGCAGAAAAGCTGCGATGATCCTTGAGAACCTTGTCTCCGAGCCTCAAAA
CAGAGGATTGCTACTCGCGTATGAAAATGCCTTCGCTGAGCTACTTTTTCAAGATGGTAAGTATTCTGATTCATTTGCTA
GGATTTTGTATGAACTCACTGCTAGATCAAATAGCAGAGTGGCTTCAGCTAGAGGAATCTGGGGT