Details for Lyrate rockcress Locus 16049235

Position : sca3 ( 5`- 1554299 .. 1555636 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049235

Protein [Map View]
MFSLKSSISSPFTQSTTHGLFTNPITRPVNPLPRTVTASMIPKKSSANMIPRNPPARQQLYQPFRPPSSPIPTKFRSLDS
AGKIEILAGRMALWFEYAPLISSLYTNGFTPPTIEELTGISSIEQNRLIVGAQVRDSILQSIHEPELIAAFDTGGAELLY
EIRLLSTTQRVAAATFIIDRNIDSKGAQDLARAIKDYPNRRGDVGWLDFDYNLPGDCLSFLYYRQSRENKNPSEQRTSML
LQALGVVESEKAKNKLNKELYGEKEEEKEKEKKKKEEEVKAIRIPVVRLKFGEVAGASSVVVLPVCKAEEGEKKILEAPM
EIIAGGDFKVVEAEKGWKRWVVLPGWNPVAAIGKGGVAVSFRDDRKVLPCDGKEEPLLVVTDRVRNFVEADDGYFLVVAE
NGLKLEKGSELKAREVKESLGMVVLVVRPPREDDEDWQTSHQNWD*

DNA
ATGTTTTCTCTCAAATCCTCAATCTCCTCACCTTTCACACAATCCACCACTCATGGATTATTCACCAACCCGATTACCCG
ACCCGTTAATCCATTACCCCGTACCGTTACTGCTTCCATGATACCCAAAAAATCCTCTGCTAACATGATTCCCAGAAACC
CTCCGGCGCGGCAACAGCTTTACCAACCGTTCCGGCCACCGTCATCTCCTATTCCAACCAAATTCCGTTCACTCGACTCC
GCCGGTAAAATCGAAATCCTCGCCGGTCGAATGGCTCTCTGGTTCGAATACGCACCTCTTATCTCTTCTCTCTACACCAA
TGGTTTCACTCCTCCCACCATCGAAGAACTCACCGGAATCTCAAGCATCGAGCAGAACCGTTTAATCGTCGGTGCACAAG
TTCGTGACTCAATTCTTCAATCTATACATGAACCGGAGCTCATTGCGGCGTTCGACACCGGTGGTGCAGAGCTTCTCTAC
GAAATCCGTCTCCTTAGCACCACGCAACGCGTTGCGGCTGCCACATTCATCATTGATCGTAATATTGATTCGAAAGGCGC
ACAAGATTTGGCGCGAGCCATCAAGGATTATCCTAACCGGCGTGGTGACGTTGGATGGTTGGATTTTGATTACAATTTAC
CAGGAGATTGTCTTTCGTTCTTGTATTACAGGCAGAGCAGAGAGAACAAGAATCCATCGGAACAGAGAACCTCCATGCTT
CTACAAGCATTGGGGGTTGTAGAATCAGAAAAGGCTAAGAACAAGTTGAACAAAGAGCTATACGGGGAGAAGGAAGAAGA
GAAGGAGAAGGAGAAGAAGAAGAAGGAAGAGGAAGTCAAAGCTATTCGGATTCCGGTGGTGAGGCTTAAGTTCGGAGAAG
TAGCAGGAGCGAGCTCCGTTGTGGTTTTGCCGGTTTGTAAAGCAGAGGAAGGGGAAAAGAAGATTCTTGAAGCTCCAATG
GAGATCATAGCCGGAGGGGATTTCAAGGTGGTTGAGGCGGAGAAAGGATGGAAGAGATGGGTAGTTCTTCCGGGGTGGAA
CCCAGTGGCGGCCATTGGGAAAGGCGGTGTGGCGGTTTCTTTCAGGGATGATAGAAAAGTACTGCCTTGCGACGGAAAGG
AGGAGCCTTTACTGGTAGTGACCGATAGGGTGAGGAATTTCGTGGAGGCCGATGACGGGTATTTCCTCGTTGTGGCTGAG
AACGGACTTAAGCTAGAGAAAGGATCAGAGTTGAAGGCGAGAGAGGTGAAGGAGAGTTTAGGGATGGTTGTTTTGGTGGT
GAGGCCGCCAAGAGAAGATGATGAAGATTGGCAGACAAGTCATCAAAACTGGGACTGA