Details for Lyrate rockcress Locus 16049228

Position : sca1 ( 5`- 7774174 .. 7774995 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049228

Protein [Map View]
MSEVRTGLLTMATIILICIGLTMTGTGLYYRKTVSQCIRETDGSFVVLGLLLLVIPQFALYAICCRSKRMFTIYIYAMIF
VCVVLGGYSLKCFIYNTTFGIAKNPAEEKRTAKQLVGRLVPESKLARVTDCIIYNHDCNFNASQNSNVWRYCCAQPRGCG
VTTMFGQPGEWSWKHQHVENHVPEECSYEYCLSCRGCQLSILKAIVHQWKYLSMFSYPSLFLVCLSLAIARSIKDTFDEP
DDYRGYYT*

DNA
ATGTCTGAGGTACGAACAGGGTTGCTAACAATGGCGACCATAATCCTCATTTGCATAGGCTTAACCATGACGGGAACAGG
TTTATATTACAGGAAAACAGTCTCACAATGTATCCGAGAAACGGATGGCAGTTTCGTTGTCCTTGGTTTGCTCTTGCTGG
TGATTCCTCAGTTTGCTCTTTACGCAATCTGTTGTCGCTCCAAACGTATGTTCACAATTTACATATATGCAATGATATTC
GTCTGCGTTGTCCTTGGTGGCTATTCTTTAAAGTGTTTCATCTACAACACAACCTTTGGAATCGCCAAGAACCCTGCTGA
GGAAAAGCGAACCGCCAAGCAACTGGTTGGCCGGCTAGTCCCTGAAAGTAAACTTGCAAGAGTCACCGACTGTATCATTT
ATAACCATGATTGTAACTTCAATGCCAGCCAAAACAGCAATGTTTGGAGGTATTGCTGCGCGCAACCGAGAGGATGTGGA
GTGACGACAATGTTCGGGCAACCAGGAGAATGGAGTTGGAAACATCAACATGTAGAGAACCATGTTCCTGAAGAATGTTC
TTACGAATACTGTCTTAGTTGCAGAGGTTGCCAGCTGAGCATCTTAAAAGCCATTGTTCATCAATGGAAATATCTCTCCA
TGTTCTCTTATCCTTCCCTCTTTCTCGTTTGTCTCAGCCTCGCCATTGCCAGGTCCATTAAAGACACTTTTGATGAACCT
GATGATTATAGAGGCTATTATACTTGA