Details for Lyrate rockcress Locus 16049183

Position : sca3 ( 5`- 11864808 .. 11863759 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049183

Protein [Map View]
MTPFSISASPSPPWPLLSPPLSSPSLNRAEFFFRNGCLSSPSLSRNTQRKAWKQLQVVAMAPEEEKLTRRNPLDFPIEWE
RPKPGRRPDIFPKFSPMKSPLPPPMPYDPPEEDEEEEEKKEEETEDDPEKEDEDQPDNQ*

DNA
ATGACGCCGTTTTCTATATCGGCATCACCTTCGCCGCCGTGGCCACTTCTCTCTCCGCCACTATCTTCACCGTCGCTAAA
CAGAGCTGAATTTTTTTTTCGAAACGGTTGTCTATCTTCACCGTCGCTAAGCCGCAATACGCAGAGAAAAGCATGGAAGC
AGTTACAGGTGGTGGCTATGGCTCCTGAGGAAGAGAAGCTCACTCGTCGTAACCCTCTCGATTTCCCTATCGAATGGGAG
AGACCGAAGCCAGGGAGGAGACCAGATATATTCCCTAAGTTTAGTCCTATGAAGTCACCGTTGCCTCCTCCTATGCCTTA
CGATCCTCCAGAAGAAGATGAAGAAGAGGAAGAGAAGAAAGAAGAAGAAACAGAAGACGACCCTGAAAAGGAAGACGAGG
ACCAACCAGATAACCAGTAG