Details for Lyrate rockcress Locus 16049131

Position : sca5 ( 5`- 17864178 .. 17863234 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049131

Protein [Map View]
MAQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGKKTSYWPVDAETEPKAGAE
PKAEAVTETKTEAETKTEAKVDAKADVEPKAAEAETKPSQV*

DNA
ATGGCTCAGACCGTTGTCCTCAAAGTTGGTATGTCATGCCAAGGCTGCGTTGGTGCCGTCAATAGAGTCTTAGGCAAAAT
GGAAGGGGTTGAGTCATTTGACATTGATATCAAGGAGCAAAAGGTGACAGTGAAAGGTAATGTTGAGCCTGAAGCAGTTT
TCCAAACAGTTTCAAAGACTGGAAAGAAGACTTCTTACTGGCCAGTGGATGCTGAGACTGAGCCAAAAGCCGGGGCAGAG
CCTAAGGCCGAGGCCGTGACTGAGACTAAAACCGAGGCTGAGACTAAGACTGAGGCTAAGGTTGATGCAAAAGCTGATGT
TGAACCAAAAGCCGCAGAAGCCGAGACTAAGCCATCACAAGTTTAA