Details for Lyrate rockcress Locus 16049111

Position : sca3 ( 5`- 12383416 .. 12384159 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_480010 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049111

Protein [Map View]
MDGGDRLRVTLLDRMSTVETSRSCLTLEAILMADKNRTSPQILSPPPSRNQSNRSLLEVMQREHRHSRDKTAWKSLREKL
RLKRNATVWISSNSIPTLDTPIPNRDNVSHQLGFLLSNSNITEEASSTEGRIRLGAVLAEERALSAREEETPAERGVEPA
RMSLMELLEENEGQMSLVNVDGEAEEEVAVTVTAAEISCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTI
LEVLDLF*

DNA
ATGGACGGTGGTGATAGGCTAAGAGTGACTTTATTAGATCGTATGTCAACAGTGGAGACTAGCCGGAGCTGTTTAACTCT
TGAAGCTATTCTAATGGCTGATAAAAACAGAACCTCGCCGCAGATTCTCTCACCGCCACCGTCTAGGAACCAATCTAACC
GGTCACTTCTTGAAGTAATGCAAAGAGAGCACCGACACAGTCGAGACAAAACCGCTTGGAAAAGTCTCCGTGAAAAGCTC
CGTCTTAAACGTAACGCTACTGTTTGGATCTCGTCTAATTCTATCCCGACTTTGGATACGCCTATTCCTAACCGGGATAA
CGTTAGCCACCAACTTGGTTTCCTCCTTTCCAACTCAAACATAACGGAGGAAGCTTCTTCGACGGAGGGAAGGATTCGGT
TAGGAGCTGTGTTGGCAGAGGAGAGAGCGTTATCGGCTAGAGAAGAGGAAACGCCGGCGGAGAGGGGAGTGGAGCCGGCG
AGGATGTCATTGATGGAGTTGTTGGAAGAGAATGAAGGGCAAATGAGTTTGGTAAATGTTGATGGAGAGGCGGAGGAGGA
GGTGGCGGTGACGGTGACGGCGGCGGAGATAAGTTGTTGTGTGTGTATGGTTAGAAGCAAAGGAGCTGCGTTTATTCCGT
GTGGTCATACGTTTTGTAGGTTGTGTTCTAGAGAGCTTTGGGTTCAAAGAGGAAACTGTCCTCTCTGTAATACCACAATT
TTAGAAGTTCTTGATCTTTTTTAG