Details for Lyrate rockcress Locus 16049095

Position : sca3 ( 5`- 3471155 .. 3474903 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049095

Protein [Map View]
MEEDDSISAESISLDTLASIRSLIINADTSVSVISSVFDFLTGLLSRGDSAILHHVLKLLSDLAFRRKELAKQIFDSILS
NLLRLQNGTAEVSHGRAAVESLAVLASLSETNPSIAAALSKIDGEVFASICLGAPISSRLWLLRNAERFNVPSSVLFTLF
LGFTKDPYPFIRKIALDGLINICNAGDFNHAHAVEGCYTRAVELLSDAEDSVRSSAVRAVSVWGNVMISSKEEELSRRDC
TDAAFLQLCSVVRDMSVDVRVEVFKAFGIIGTASESIILQTLSKKVLGAGKGKKPQNHLSNGSADVSAAAGVFIHGFEDE
FYQVREAAVNSFHSLSVNSIKFPDEAVYLLMDMLYDDYMVVRLKALEALHHIADLGNLKIQETYMPAFLDAIVDTSENIR
VEARNILKLAKLPDLKLVNNCVDGVLKSLEMYPQDEPAILSALFHFGQKHPNFLVSMVKRFSEKLGTASGNKLEFNSRQL
SASLMLIISAPLSNKQSITSIPPLAFSYSLAMLGKFSSGLHDMMDQYMLLAYLTHCAILSSSSGTEFNKGDIFFQAYRDS
NADLSGNPVLLPSKDIPAESKYMASKAELEIGNQALKFLNHILLKIKAAWLLSQSGCSKEALRALRACKQELATLTADSS
ISNGTLEFICQYVHVIELLAQVWPHFEYARHISTCRSVELELLMKEIEIKLMEIRCRFTGLSTEESLVIELVIFGCLLRL
YKFEICCRLSCTEKLSSTISQLELHHEQQCTKPSEFLTETKKSLKEIGSSDDINSCRLLHLIKIFNCFSPEQFTLSGNLQ
CVSAELEIPGNGPYSPISFVPGLPVAIPCEIMLLNVPRDTCLWLRISRSDETCQFVYLDPNLYNGDGREKRFMFTAVTYM
TPRAVVFTLRVSIGIECLFEDISYRKQRHGPKHPVAYLCKEREVHLSLVSRT*

DNA
ATGGAGGAAGACGACTCGATCTCTGCTGAATCAATCTCTCTCGACACTCTAGCTTCTATTAGATCACTCATTATCAACGC
CGACACTTCCGTCTCGGTGATTTCCTCAGTTTTCGATTTCCTTACTGGTCTTCTGAGTCGAGGAGACTCGGCGATTCTTC
ACCATGTCCTCAAGCTACTCTCCGACCTAGCTTTCCGGCGAAAGGAATTAGCAAAACAAATCTTCGACTCAATCCTGTCC
AACTTACTCCGCCTTCAAAACGGCACCGCCGAGGTGAGCCACGGACGCGCCGCCGTGGAATCGCTTGCTGTGCTTGCGTC
ATTATCCGAAACAAATCCTAGCATCGCCGCCGCGCTTTCCAAAATCGACGGCGAGGTATTTGCGTCGATATGCCTCGGAG
CACCTATATCTTCTCGACTGTGGCTACTTAGGAACGCGGAGAGGTTCAATGTCCCGTCGTCGGTACTTTTCACCTTGTTT
TTAGGGTTTACCAAGGATCCGTATCCATTTATCAGAAAAATAGCTCTGGATGGATTGATTAATATATGTAACGCTGGTGA
CTTTAATCACGCTCATGCCGTAGAAGGTTGCTATACTCGTGCTGTTGAGCTTCTAAGCGATGCTGAAGATAGCGTCAGAT
CTTCTGCAGTTCGTGCCGTCAGTGTGTGGGGCAACGTGATGATATCATCCAAGGAAGAAGAGCTGAGCAGAAGAGATTGT
ACAGATGCTGCTTTTCTCCAGCTTTGTTCTGTTGTGAGAGATATGAGTGTAGACGTGAGGGTTGAGGTCTTCAAGGCATT
TGGGATTATAGGAACTGCATCAGAAAGCATTATACTGCAAACACTTTCTAAAAAAGTATTGGGAGCCGGAAAAGGGAAGA
AACCGCAGAATCACCTTTCTAATGGATCAGCTGATGTCAGTGCTGCAGCTGGAGTTTTCATCCATGGTTTTGAAGATGAA
TTCTACCAGGTACGGGAAGCTGCGGTTAACTCCTTCCACTCCCTCTCAGTAAATTCTATCAAATTCCCAGATGAAGCTGT
GTATCTATTGATGGATATGCTGTACGATGATTATATGGTTGTCAGGTTGAAAGCTTTAGAGGCATTGCATCATATAGCAG
ACTTGGGGAACCTGAAGATACAGGAAACTTATATGCCCGCCTTTTTGGATGCTATTGTTGATACTTCTGAAAACATTAGA
GTTGAGGCTAGAAACATTCTTAAATTGGCAAAGCTGCCTGATCTGAAGCTGGTCAACAATTGTGTTGATGGTGTCCTAAA
AAGTTTAGAGATGTATCCACAGGACGAACCTGCTATCTTGTCTGCTCTGTTCCATTTCGGACAAAAACACCCAAATTTCT
TAGTCAGTATGGTCAAGAGATTTAGTGAAAAGTTAGGGACAGCTTCCGGAAATAAACTGGAATTCAATAGCCGACAGTTA
TCTGCTTCTCTGATGCTGATAATCTCAGCCCCTCTCTCAAACAAACAAAGCATCACTTCGATACCACCTCTGGCATTTTC
ATATTCACTTGCAATGCTGGGGAAATTCTCTAGTGGACTTCATGATATGATGGACCAGTATATGCTTCTGGCTTACTTGA
CTCATTGCGCTATTCTTTCGTCTTCTTCGGGGACAGAATTCAACAAAGGAGATATATTTTTTCAGGCATATAGGGACAGT
AATGCAGATCTTTCCGGAAACCCCGTCCTATTACCCAGCAAAGATATACCTGCTGAGAGCAAATACATGGCTTCCAAAGC
AGAACTGGAAATTGGAAATCAAGCACTTAAGTTTCTTAACCATATACTGTTGAAAATAAAGGCTGCCTGGTTGTTATCAC
AATCAGGGTGCTCGAAAGAAGCACTCCGAGCATTGAGGGCTTGCAAACAGGAGTTAGCAACTTTGACAGCCGATTCTTCA
ATCTCCAACGGTACATTAGAATTTATCTGTCAGTATGTTCACGTAATAGAACTTCTCGCTCAAGTATGGCCTCATTTTGA
ATACGCAAGACACATCAGCACGTGTAGATCTGTAGAACTGGAACTACTGATGAAAGAGATAGAGATAAAACTAATGGAGA
TAAGGTGTAGATTCACAGGCCTGTCTACGGAGGAGTCATTAGTAATAGAGTTAGTAATTTTTGGTTGCTTGTTAAGGCTA
TATAAATTTGAAATTTGCTGCCGCCTTAGCTGCACGGAGAAGCTATCTTCAACAATATCTCAATTAGAGCTCCACCATGA
ACAACAATGCACCAAACCATCAGAATTTTTAACCGAAACTAAGAAGTCATTGAAAGAGATTGGGAGCTCTGATGATATAA
ATAGCTGTAGACTGCTTCATCTCATCAAGATATTCAATTGCTTCTCTCCAGAACAGTTTACGCTTTCTGGTAATCTGCAG
TGTGTCAGCGCAGAGCTAGAGATTCCTGGTAATGGTCCTTACAGTCCGATTTCCTTTGTGCCTGGTCTCCCGGTGGCTAT
ACCGTGTGAGATCATGCTGCTTAATGTGCCAAGAGATACCTGTTTGTGGCTGAGAATATCTAGAAGCGATGAAACTTGCC
AGTTTGTGTACTTGGATCCAAACCTCTACAATGGAGATGGGAGAGAGAAGAGGTTCATGTTTACTGCAGTAACGTACATG
ACCCCGAGGGCTGTTGTGTTCACATTGCGGGTTTCAATAGGCATAGAGTGTCTGTTTGAAGACATTAGTTACAGAAAACA
GCGTCATGGTCCCAAGCATCCAGTGGCCTATCTGTGTAAGGAAAGAGAAGTTCACCTTTCTCTTGTTTCAAGAACCTAA