Details for Lyrate rockcress Locus 16049068

Position : sca3 ( 5`- 5027636 .. 5029105 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049068

Protein [Map View]
MGETLITTLSMENYHPSTLLSMDSGAFTHEESERDINRSLLLTGPPDINLPLSSEASPSLLLWNEHCDILDVGLGPQLYE
PEAVVHVPKVAKKYNKRVDSAWGAWLFFSFYFKPVLDEKSKSKLTRDSNGLSGYDKSDLQLDSFLVQHDMENMYMWVFKE
KPENALGKMQLRSYMNGHSREGERPFPFSVDKGFVRSHRMQRKHYRGLSNPQCLHGIEVVYSPNLSVLNEDEKKKWTELT
GRDVNFAIPAEASDYGSWRNLPNTEFEAERPLPLVKANGHTHLKKLNGTCLNLSTHSPDHAVDTVEVQPAGSNKRKRDCL
ALGNCDDSSSSEKSLDMKIHATELPWSNDFSGVIKNVYGPVTAAKTIYEDDKGFLIVMSLPFVDSGRVKVTWRNTPTHGI
VKISCVSTACEPFIKRHDRTFKLTDPTPEHCPPGEFVREVSLPNRIPDDATLEAYRDETGTTLEVLVPKHRMGPEEHEVR
VCLRPFVLE*

DNA
ATGGGTGAGACTCTCATCACCACCCTGTCTATGGAGAACTATCACCCGTCAACACTACTATCCATGGATTCAGGTGCTTT
TACTCATGAAGAATCAGAGAGGGATATAAATCGGTCGCTCCTACTTACTGGACCGCCTGATATTAATCTCCCACTCTCAT
CTGAAGCAAGCCCATCTCTGCTTTTGTGGAACGAACACTGTGACATCTTAGACGTTGGACTCGGCCCTCAGCTATATGAG
CCTGAGGCTGTTGTTCATGTGCCTAAGGTTGCTAAGAAGTACAACAAGCGTGTTGATAGTGCATGGGGTGCTTGGCTTTT
CTTCAGTTTCTACTTCAAACCTGTTTTGGATGAGAAGTCCAAAAGTAAGTTAACGAGGGACAGCAATGGCTTGTCCGGGT
ATGATAAATCTGATTTGCAGCTCGACTCCTTCTTGGTTCAGCATGACATGGAGAATATGTACATGTGGGTGTTCAAGGAA
AAGCCTGAAAATGCCCTTGGCAAGATGCAGCTTAGGAGTTACATGAACGGACACTCACGCGAGGGTGAACGTCCTTTCCC
TTTTAGTGTGGACAAAGGTTTTGTCCGCTCTCATAGAATGCAGCGGAAACATTACCGTGGTCTCTCTAACCCACAGTGCC
TCCATGGAATCGAAGTTGTTTATTCACCCAACCTTTCTGTACTCAACGAGGATGAAAAGAAGAAGTGGACAGAACTCACA
GGTCGAGATGTGAACTTTGCTATTCCAGCTGAAGCTAGTGATTACGGTTCATGGAGGAATCTCCCAAACACGGAATTTGA
GGCTGAGCGACCTCTTCCTCTGGTTAAAGCTAATGGGCACACCCACCTGAAAAAGCTGAACGGTACCTGTCTGAACCTGT
CTACACATTCCCCAGACCATGCAGTTGATACAGTGGAAGTTCAACCCGCTGGTAGCAATAAACGCAAAAGGGATTGTCTT
GCTCTAGGAAACTGCGATGACTCGAGCTCAAGTGAGAAATCTCTGGACATGAAAATTCATGCAACGGAGCTACCTTGGTC
AAATGATTTCAGCGGGGTGATAAAAAATGTCTATGGTCCAGTCACAGCCGCAAAAACAATATATGAAGACGACAAAGGGT
TCTTGATAGTTATGAGCCTACCGTTTGTTGATTCGGGGAGGGTGAAAGTGACATGGAGGAATACACCAACACATGGAATA
GTGAAGATATCATGTGTAAGTACAGCATGTGAGCCATTCATCAAGAGACATGATAGAACATTTAAGCTAACAGATCCAAC
ACCAGAGCATTGCCCACCGGGAGAATTTGTCCGCGAAGTCTCCCTGCCGAACAGGATTCCAGATGACGCAACACTTGAAG
CTTACCGGGACGAAACAGGAACAACACTAGAGGTTTTAGTGCCTAAACACCGAATGGGACCAGAGGAGCATGAGGTTCGC
GTCTGTCTCCGTCCGTTCGTGCTAGAGTGA