Details for Lyrate rockcress Locus 16049062

Position : sca3 ( 5`- 5758320 .. 5759886 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16049062

Protein [Map View]
MMSLSGSSGRTIGRPPFTPTQWEELEHQALIYKYMVSGVPVPPELIFSIRRSLDTSLVSRLLPHQSLGWGCYQMGFGRKP
DPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLDQNQTRTTPLTSPSLSFHNNNNPSPTLSSSSSSSTTY
SASSSSMDAYSNSNRFGVGGSSSHTRGYFNSHSLDYPYPSTSPKQQQQPLHHASALSLHQNTTSTSQFNVLASPTDHKDF
RYFQGIGERVGVGERTFFPEASRSFQDSPYHHHQQPLTTVMNDPYHHCSTDHKIDHHHHTYSSSSSSQQHLHHDQEHDHR
QQQQQCFVLGADMFNKPTRSVLTNSSRQDQNQEEEEKDSSESSKKSLHHFFGEDWAQNKNSSDSWLDLSSHPRLDTGN*

DNA
ATGATGAGTCTAAGTGGAAGTAGTGGGAGAACAATAGGAAGGCCTCCATTTACACCAACACAATGGGAAGAACTGGAACA
TCAAGCCCTAATCTACAAGTACATGGTCTCTGGTGTTCCTGTCCCACCTGAGCTCATCTTCTCCATTAGAAGAAGCTTGG
ACACTTCCTTGGTCTCTAGACTCCTTCCTCACCAATCCCTTGGATGGGGATGTTACCAGATGGGGTTTGGAAGAAAACCA
GATCCAGAACCAGGAAGATGCAGAAGAACAGATGGTAAGAAATGGAGATGCTCAAGAGAAGCTTACCCAGATTCAAAGTA
CTGTGAAAAACACATGCACAGAGGAAGAAACCGTGCCAGAAAATCTCTTGATCAGAATCAGACAAGAACAACTCCTTTAA
CATCACCATCTCTCTCATTCCACAACAACAACAACCCAAGTCCCACCTTGTCTTCTTCTTCTTCATCTTCAACTACTTAT
TCTGCTTCTTCTTCTTCGATGGATGCCTACAGTAACAGTAATAGGTTTGGTGTTGGTGGAAGTAGTAGTCACACTAGAGG
TTACTTTAACAGCCATTCTCTTGATTATCCTTATCCTTCTACTTCACCTAAACAACAACAACAACCTCTTCATCATGCTT
CCGCTTTGTCACTTCATCAAAACACTACTTCTACTTCTCAGTTCAATGTCTTAGCCTCTCCTACTGACCACAAAGACTTC
AGGTACTTTCAAGGAATTGGGGAGAGAGTTGGAGTTGGGGAGAGAACGTTTTTTCCGGAAGCATCTAGAAGCTTTCAAGA
TTCTCCATACCATCATCACCAACAACCGTTAACAACAGTGATGAATGATCCGTACCACCACTGTAGTACTGATCATAAGA
TTGATCATCATCATCACACATACTCATCCTCATCATCATCTCAACAACATCTTCATCATGATCAAGAGCATGATCATCGA
CAGCAACAGCAACAGTGTTTCGTTTTGGGCGCCGACATGTTCAACAAACCCACAAGAAGTGTCCTTACAAACTCATCAAG
ACAAGATCAAAATCAAGAAGAAGAGGAGAAAGATTCATCGGAGTCGTCGAAGAAGTCTCTTCACCATTTCTTCGGTGAGG
ACTGGGCACAGAACAAGAACAGCTCAGATTCTTGGCTTGACCTTTCTTCCCACCCAAGACTCGACACTGGTAATTAA