Details for Lyrate rockcress Locus 16049041

Position : sca3 ( 5`- 1071035 .. 1069545 -3` )
Annotation : [B2G] peroxisomal protein pex19 family protein
External links : CoGe
PGDD synteny : 16049041

Protein [Map View]
MSNTHTDDLDELLDSALDDFKDLNLSQRNQREAQEEEKKKKEETVLLPSGVQGLGMGLPDMRIKKKGKQKVSKEDHVAEA
LDKLREQTRETVKGLESISSKQLPASDDDGMVEDLLKQFEDLTGSQDLESIVETMMQQLLSKDILHEPMKELGARYPKWL
KENEASLTKEDYKRYSQQYKLIEELNAVYENEPNNSSKIMEIMQKMQECGQPPSDIVKEIDPGFDFASLGQISPEMLESS
PNCCIM*

DNA
ATGTCCAACACTCACACCGATGACTTAGACGAGCTTCTCGATAGTGCATTGGATGATTTCAAAGATCTCAATCTTTCTCA
AAGAAATCAAAGGGAAGCGCAAGAGGAGGAGAAGAAGAAGAAAGAAGAGACGGTTCTATTACCAAGTGGAGTTCAAGGTC
TTGGAATGGGATTACCAGATATGAGAATCAAGAAGAAAGGAAAACAAAAGGTTTCCAAAGAGGATCATGTTGCTGAAGCT
CTTGATAAGCTTAGGGAACAAACTAGGGAAACTGTCAAAGGATTGGAATCCATTTCTTCTAAGCAGCTGCCAGCTTCTGA
TGATGATGGAATGGTTGAGGATCTTCTCAAGCAATTCGAGGATCTTACTGGATCCCAGGACTTGGAATCAATAGTCGAAA
CGATGATGCAACAGCTATTGTCGAAGGATATTCTTCACGAACCAATGAAGGAGCTTGGTGCAAGATATCCGAAATGGCTA
AAAGAGAATGAAGCCAGTCTAACCAAAGAAGACTACAAACGCTATTCACAACAGTACAAACTAATAGAAGAACTCAATGC
GGTATACGAGAATGAACCTAACAATTCATCTAAGATAATGGAGATCATGCAGAAGATGCAAGAATGCGGACAACCCCCAA
GCGATATAGTTAAAGAGATTGATCCCGGGTTTGATTTCGCAAGTCTAGGCCAAATATCTCCTGAGATGCTGGAGTCCTCA
CCAAATTGCTGTATAATGTGA