Details for Lyrate rockcress Locus 16049029

Position : sca3 ( 5`- 10317019 .. 10318562 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16049029

Protein [Map View]
MEAGSSNSSGQLSGRVVDTRGKHRIQAELKRLEQEARFLEEELEQLEKMDNASASCKEFLDSVESKPDPLLPETTGPVND
TWDQWFEGPKEAKRCGCSIL*

DNA
ATGGAAGCGGGTAGCTCCAATTCGTCGGGTCAGCTCTCCGGGCGGGTCGTTGATACAAGAGGCAAACATAGGATTCAAGC
TGAACTCAAAAGGCTTGAACAAGAAGCTCGATTCTTAGAGGAAGAGCTGGAGCAGCTTGAAAAGATGGACAATGCATCAG
CGTCATGCAAAGAGTTCTTAGACAGTGTTGAGAGCAAACCCGATCCTCTTCTTCCCGAAACAACAGGTCCGGTGAATGAC
ACATGGGATCAATGGTTCGAAGGCCCTAAAGAAGCTAAACGATGTGGCTGCTCCATTCTTTGA