Details for Lyrate rockcress Locus 16048962

Position : sca3 ( 5`- 11762967 .. 11761569 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479954 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16048962

Protein [Map View]
MGKLQKIGRVWDCFFLPTNQCSCFCLNTLGDDEEEVFEKKPLIDSSAEKSGKVMRLKDVVAADHRQTLAFHLKPKIVELK
VSMHCYGCAKKVEKHISKLDGVTWYKVELESKKVVVKGNIMPVDVLESICKVKNAQLWSSSS*

DNA
ATGGGGAAGCTCCAGAAAATTGGGAGAGTATGGGATTGTTTTTTTCTTCCGACAAATCAGTGTTCATGTTTTTGTCTAAA
CACTCTAGGAGATGATGAAGAAGAAGTGTTTGAGAAGAAGCCATTGATAGATTCTTCAGCAGAGAAATCTGGGAAGGTCA
TGAGATTAAAAGATGTTGTAGCTGCTGATCATCGCCAGACTCTTGCCTTTCATCTTAAGCCTAAGATAGTGGAGCTAAAG
GTGTCAATGCATTGCTACGGATGTGCGAAGAAAGTCGAGAAGCATATTTCTAAATTAGACGGAGTGACATGGTACAAAGT
GGAGCTAGAGAGCAAGAAGGTGGTGGTGAAGGGGAACATAATGCCAGTAGATGTGTTAGAGAGTATTTGTAAAGTCAAGA
ATGCTCAGCTTTGGTCTTCTTCTTCTTGA